KEGG   Pseudomonas aeruginosa M18: PAM18_3376
Entry
PAM18_3376        CDS       T01973                                 

Gene name
stk1
Definition
(GenBank) serine-threonine kinase Stk1
  KO
K11916  serine/threonine-protein kinase Stk1 [EC:2.7.11.-]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3376 (stk1)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     PAM18_3376 (stk1)
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAM18_3376 (stk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 APH_6_hur Kdo
Other DBs
NCBI-ProteinID: AEO75859
Position
complement(3755570..3756559)
AA seq 329 aa
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAG
GMGTVYRARDLLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRL
FTFDVDTACQRAYIVMELMPGLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVL
HGDLKPSNVMLGEEGVRLFDFGLGQAQAGILDGLPQLSRGRIDAWTPGYAAPELLEGAPL
SPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQLRAPGHLPRRCWPALRTALSL
DPERRCIGVRELQEALGARRSWLAGVLAR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaacgaaccgctgtcgtcgctggagctgctgccggaggaggagggcggcgcgaacctg
acctatttcgccttcgccgccccgaccgcctcggcgccggacctgccggcggtgttgccc
ggtccgctgccggacgttctttccgggcgctaccgtctggagcggatgctcggcgccggc
ggcatggggacggtctaccgtgcccgggacctgctccatgagcagttcggcgacccggcg
ccgctggtagcgctgaagctgctcaacgagtcggtcgccgagtcacccgacgccagcgcc
ttgctctatagcgagttcgccctgacccggcgcttgcgccatccgaacgtcgtgcgtctg
ttcaccttcgacgtcgacaccgcatgccagcgcgcctacatcgtcatggaactcatgcct
ggcctgccgctcgaccgcctgctctgcgagcgtcccgaaggcctgccctggtccgagctg
agcgcgatcgcccggccgttgctggatgttctggcctacgtccacgaacaaggagtactg
catggcgacctgaagccgagcaacgtgatgctcggcgaagagggcgtgcggctcttcgac
ttcggcctcggccaggcgcaggcaggcatcctggatggcctgccgcagctcagccggggc
cgcatcgacgcctggactccgggctacgccgctcccgaactgctcgagggcgcgccattg
tcgccggcggccgacctgtatgcgctggcctgcgtcctctacgaactggccgacggtcgc
catccgttccgccgcctgccctcgaaccaggcccgggagcaggggctggagcgccagctg
cgcgcgcccggacacctgcctcggcgctgctggccggcgctgcgtaccgccctgagcctc
gaccccgaacggcgctgcatcggcgtccgcgaattgcaggaagcgctgggcgcgcggcgt
tcctggctggccggcgttcttgcccgttga

DBGET integrated database retrieval system