KEGG   Pseudomonas aeruginosa M18: PAM18_3377
Entry
PAM18_3377        CDS       T01973                                 

Gene name
stp1
Definition
(GenBank) serine/threonine phosphoprotein phosphatase Stp1
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02025  Biofilm formation - Pseudomonas aeruginosa
paf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAM18_3377 (stp1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_3377 (stp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3377 (stp1)
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PAM18_3377 (stp1)
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAM18_3377 (stp1)
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-ProteinID: AEO75860
Position
complement(3756556..3757284)
AA seq 242 aa
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAE
LPARAGFDERLNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVG
DSRCYLWRGQRLYQLSRDHSLLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVL
ELEVHPGDVFLLCSDGLYEELSADALGRALSLASPQVAVERLFDGALSGAARDNLTAVVI
RQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgcaacgcaccgaaccctggcgcagcgcggcacgcacggatcgcggcaaggtccgcgcg
cgcaacgaggatgccttcctggactgcccggatcgcgggctctgggcggtcgccgatggc
atgggcgggcaccaggccggcgacctggccagccggatgatcgtcaccagcctggcggaa
ctgccggcccgggcgggattcgacgagcgcctgaacgcgatgcgccagtgcctgcactgg
ctcaaccggcgcctgggcgaggaactcaccctcagcgccgaacgcggcgacaggatcatc
ggcagtacggtggtggcgctggtcgtggagggttcgcgggcggcctgcgtgtgggtcggc
gacagccgctgctacctgtggcgcggccagcggctgtaccagctgtcccgcgaccactcg
ctgttgcagcgactggtcgacgaacggcggatggatatcgagcaggcccgcgcctatccc
tcggcgcgcgcgctgacccgtgccgtcggcgctagcgaacaactggtgctggacgtgttg
gaactggaggtgcatcccggtgatgtcttcctgctctgcagcgacgggctctacgaagag
ctgagcgccgatgcgctgggtcgcgcgttgagcctggcatcgccgcaggtggcggtggag
cggctgttcgacggtgccctgagcggcgccgcacgggacaacctgacggcagtggtgatc
cgccaatga

DBGET integrated database retrieval system