KEGG   Pseudomonas aeruginosa M18: PAM18_3379
Entry
PAM18_3379        CDS       T01973                                 

Definition
(GenBank) putative outer membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAM18_3379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3379
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3379
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AEO75862
Position
complement(3760827..3761696)
AA seq 289 aa
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSL
NPLVAAASELLSEVVRLKHSTVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYV
LCTVVDEAVVTTPWGNESEWSKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELM
YLCLALGFEGKYRVMARGVLDLDGISDALYRQIRQLRGDVPRELSPHWQGLSDQRRGLVR
IVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSLDAAAGQPGS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatcaaggaaagggaataccacgaggacgagaagaccgtcctcctcgatcaccaggga
caggtaccggcccaggggccgctgaccgatttcgccgaaccgccgcgcttcgaacagctc
gaggagcggatgatctacgcggcgcgcctgcgtccgggcgaggccttcaacgtcagcctg
aacccgctggtggcggcggcttccgaactgctttcggaagtggtccggctcaagcacagc
accgtgctggagaaccttgcggcgctcaaggagcggttgacctccgccatgaagctcttc
gaattccgcgccgtgcaggatggcgtggaaaacagccaggtcatggcggcgcgctacgtg
ctgtgcacggtggtcgacgaggcggtggtgaccaccccgtggggcaacgaaagcgaatgg
tcgaagatcagcctgctgagcagcttccataacgagaccttcggcggcgagaagttcttc
cagttgctcgaccggctgtcgaagaacccggtcaagcacctgccgatgctggagctgatg
tacctctgcctggccctcggcttcgagggcaagtaccgggtgatggctcgcggcgtgctc
gacctggacggtatttccgatgcgctctaccggcagatccgccagttgcgcggcgacgtg
ccgcgcgaactgtcgccgcactggcaggggctcagcgaccagcgtcgcggcctggtgcgg
atcgtgccctggtggatggtggcgctgttcaccctggtctgcctagtggtgatgtattcg
ggattcgcctgggttctcggcgaacaacgcgacacggtgctgcagccttaccagtcgctc
gatgcggcggcaggacagcccggttcgtaa

DBGET integrated database retrieval system