KEGG   Pseudomonas aeruginosa M18: PAM18_3380
Entry
PAM18_3380        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_3380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3380
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3380
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AEO75863
Position
complement(3761699..3763030)
AA seq 443 aa
MNVHKIVWQEGMLLRPQHLQHNDRYYDNQMKARTQLLGSYNWGFLALELDRQFLNMGKLV
ISQASGVLPDGSLFELGGNTEPLALDVPPNTSNVPIYLALPLVTGNHIEARRPEQAEVLA
RYTAYDLEVADSNAGEDSMVQVSCARPDFRLLLGEQQSDQAYVKLKVAVVLDTTPDGVIS
LDPDFVPSYLHAHASAYLLSCLKEVISMLGHRGDTIAERIRSNGKVGGAEVGDFMMLQLI
NRTELLLRHYLGLEQVHPEQLYRVLLTMLGDLATFGSESKRPRLDSRYQHSDQGASFRRL
MEAIRQVLSMVLEQHAIELPLQARQYGILVSPLHDHKLLGSASFVLAASANCESEELRQR
LPAHLKVGAVEHIRQLVNLHLPGIRVKPLPVAPRQIPFHSNKTYFILEPNAEDMAQLERS
GGFAFHVSGEFSELELKFWAIRN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaacgtgcacaagatcgtctggcaggaaggcatgctgctgcgcccgcagcacctgcaa
cacaacgaccgctactacgacaaccagatgaaggcccggacccagttgctgggcagctac
aactggggcttcctcgccctggagctggaccgccagttcctcaacatgggcaagctggtg
atcagccaggcctccggcgtattgcccgacggcagcctgttcgaactcggcggcaacacc
gagccgctcgccctcgacgtgccgcccaatacctcgaacgtgccgatctacctggccctg
ccgctggtcaccggcaaccacatcgaggcgcgccggccggagcaggccgaggtcctggcg
cgctataccgcctatgacctggaggtggcggactccaacgccggcgaggattccatggtg
caggtcagctgcgcgcggccggattttcgcctgctgctcggcgagcagcagagcgaccag
gcctacgtcaaactgaaggtggcggtggtgctggataccacgccggacggggtgatcagc
ctcgaccccgacttcgtgccgagctacctccacgcccacgcatccgcctacctgctgtcc
tgcctgaaggaggtgatcagcatgctcggccatcgcggcgacaccatcgccgagcgtatc
cggtccaatggcaaggtcggcggcgcggaggtcggcgatttcatgatgctgcaactgatc
aatcgcaccgagttgctgctgcgccactacctgggattggagcaggtgcatccggagcag
ttgtaccgggtgctgctgaccatgctcggcgacctcgccaccttcggcagcgagagcaag
cgtccgcgcctggacagccgttaccagcacagcgaccagggcgccagcttccgcaggctg
atggaggcgatccgccaggtcctgtcgatggtgctcgagcagcatgccatcgaactgcct
ctccaggcccgccagtacggcatcctggtctcgcccctgcacgaccacaagctgctcggc
agcgcctcgttcgtgctcgccgccagtgccaattgcgagtcggaggaactgcgccagcgg
ctgcccgcgcatctcaaggtgggtgcggtcgagcacattcgccaactggtcaacctgcac
ctgccggggatccgggtcaagccgctgccggtggcgccgcggcagatcccgttccactcc
aacaagacctatttcattctcgaacccaacgccgaggacatggcccagctggagcgctcc
ggcggtttcgcgttccacgtatccggcgagttctccgagcttgaactgaaattctgggcc
atcaggaactga

DBGET integrated database retrieval system