KEGG   Pseudomonas aeruginosa M18: PAM18_3381
Entry
PAM18_3381        CDS       T01973                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAM18_3381
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3381
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3381
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AEO75864
Position
complement(3763027..3763542)
AA seq 171 aa
MIAMSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPV
VVRLFELKHPVAFENADFFSLYERPKETLDPDLVNSEELELRPGERVELKLSVEEGSRYV
GVLAAYRDLGEASWRYVVPVTAKELTRVELKLGQKGILNAGELLGKAGDAR
NT seq 516 nt   +upstreamnt  +downstreamnt
atgatcgccatgtctcgtcgcccgatcccgccagccagggcgctggccatgctcgccgtc
ctggcgctgctggccggctgttccacgctgtcgccgtattccagactgaccaagctcgac
ctcgccctgagcgccggcgagcgggtcaatcccgacctcaatggccggccgtcgccggtg
gtagtgcggctgttcgagctgaaacacccggtggcgttcgagaacgccgacttcttcagc
ctctacgaacgtcccaaggagaccctggaccccgacctggtgaacagcgaggagctggag
ctgcgtcccggcgagcgggtcgaactcaagctcagcgtggaggaggggagccgctacgtg
ggcgtgctcgccgcctaccgcgatctcggcgaggcaagctggcgctacgtggtgccggtc
acggcgaaagagctgacccgggtagagctgaagctgggccagaagggcatcctgaatgcc
ggcgaattgctcggcaaggcgggtgacgcgcgatga

DBGET integrated database retrieval system