KEGG   Pseudomonas aeruginosa M18: PAM18_3383
Entry
PAM18_3383        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paf03000]
    PAM18_3383
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3383
Transcription factors [BR:paf03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    PAM18_3383
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAM18_3383
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 GAF_2 HTH_30 HTH_50 AAA_16 AAA_2 HTH_1 AAA AAA_7 TIP49
Other DBs
NCBI-ProteinID: AEO75866
Position
complement(3764979..3766490)
AA seq 503 aa
MFSRVPQPLAFAEALLAQFGALSRETDITALLGGFARAVGELSGCELSQLYLLDQTHTAL
TLNAECRDGLLQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQP
WLSLLCVPLVSPEKTVEGMVVCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGE
PQGPSSAPVVSGYGLIGRSAAMRETCRLISKVLHNPYTVLLQGETGTGKEVVARAIHEYG
PRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRPGLFDAADGGTLLLDEIGDMP
LSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFREDLYYRLAQFP
IELPPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGEVLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAAREL
GLPRRTLIYRMGRLNIHFGDPRT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgttcagccgcgtaccgcaacccctggccttcgccgaagccctgctcgctcagttcggc
gcgctgtcgcgggaaaccgacatcacggccctgctgggcggtttcgcacgcgcagtcggc
gaactcagcggctgcgagctgagccagttgtatctgctcgaccagacccataccgcgctc
accctcaacgccgaatgccgggacggcctgttgcaggcgctggagccgtcgagcctgccg
gcggactacaccggcgagcagttgctgcagttcgccctgtgccagaaccgcgtggtcagt
ctcgtcgacctgccgtcgcggctgcacgagaccggcttcctgccggcaggggagcagccc
tggctgtccctgctctgcgttccgctggtgagcccggagaaaacggtcgagggcatggtg
gtctgcgctacccggcgcccactggacctgcagggattcgcccatccactgggccagctg
ggctcgttcgtgctggcccagctgcatctgctgcaacgcctctcgcaaccctccggcgag
ccgcagggaccgtccagcgcaccggtggtcagcggctacgggctgatcggcaggagcgcg
gcgatgcgtgagacctgccgcctgatcagcaaggtcctgcacaacccctataccgtgttg
ctgcagggcgagaccggcaccggcaaggaggtggtcgcacgggcgatccacgagtacggc
ccgcggcgtgcacaggcattcgtggtgcagaactgcgcggcgtttccggaaaacctgctg
gaaagcgagctgttcggctaccgcaagggcgcctttaccggtgccgagcgcgatcgtccc
gggttgttcgatgccgcggatggcggaaccctgttgctcgacgaaatcggcgacatgccc
ctgtcgctccaggccaagctgttgcgcgtgttgcaggaaggcgagattcgcccgctcggc
ggcaacgacacgcacaaggtcgatgtacgcatcatcgccgctacccaccgtgacctcgcc
ctgctggtccgcgatggcaagttccgcgaagacctctactaccggctggcgcagtttccc
atcgagttgccgccgttgcgccagcgcgagggcgacgccctcgaactggcccggcatttc
gccgagcgcgcctgcgtgttcctacgccgcgcgccgctgggctggtccgcggaagcgctg
gaactgctcgacggctatggctttcccggcaacgttcgggagctgaagggactggtggaa
tgcgcggtactgctctgcgaaggcgaggtgctgctggccgaacacttttccctgcgcgcg
cccccggaagcggaggcgccgctcaagctgcgcgagcatctggagcagatcgaacgggac
ctgctgctcgcctgcctgcgcaggaacgctggcaaccagaccctcgccgcgcgcgaactg
ggtctgccgcgacgaaccctgatctatcgcatgggacgcctgaacattcatttcggcgat
ccccggacctga

DBGET integrated database retrieval system