KEGG   Pseudomonas aeruginosa M18: PAM18_3384
Entry
PAM18_3384        CDS       T01973                                 

Definition
(GenBank) putative ClpA/B-type protease
  KO
K11907  type VI secretion system protein VasG
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02025  Biofilm formation - Pseudomonas aeruginosa
paf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAM18_3384
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_3384
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3384
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3384
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_22 AAA_16 TniB Clp_N Sigma54_activat AAA_7 NACHT RsgA_GTPase AAA_29 AAA_25 Hpr_kinase_C
Other DBs
NCBI-ProteinID: AEO75867
Position
complement(3766501..3769128)
AA seq 875 aa
MINVDLQQLIQALDADTRRDLEGSAERCVARGGSKVLVEDLLLGLLERPQGLLARALQDA
AVDAGELNAALQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLR
NPLRYAGSRYQPLLARLDIERLKDFALSQPLEGAPSGKPGGGESLLQRFTHNLTQQARDG
KLDPVLCRDGAIRQMVDILARRRKNNPIVVGEAGVGKTAIVEGLASRIAAGEVPPALRDV
ELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAALRPTILFIDEAHTLIGAGGQAGGSDA
ANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSVAEAVTILRGLAR
VYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLERL
RGELAEGERQRQALRRDAEAGLPIDHDALQALEERLAQAESERHVQEDQWSRQRELAERL
LALRQQLARAREANREEQGGEADAETFPADEHGGVEALEKALHETRQALADAQAQGRLVS
FEVCPRLVAEVIGAWTGVPVEQLAREHNAKVMGFADDLRARIRGQEQAVSALDRAMRATA
AGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFITTINMSEFQEKHTVSRLIG
APPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVLNLFYQIFDKGVANDGEGREID
FRNTLILMTSNLASEHIAALCQDGARPSAELLEETIRPALSRHFKPALLARMRVVPYYPV
GGPVLRELIEIKLQRLGERLARRQLAFDYSQALVGHLAERCTQSDSGARLIDHLLDTHLL
PLVADRLLEAMARDERLERVHATLGEHGRVLCEFA
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgatcaacgtagacctgcaacaactgattcaggcgctggatgccgacacccggcgcgac
ctcgaaggctcggccgagcgctgcgtagcccgtggcggcagcaaggtactggtggaggac
ctgttgctgggcctgctggagcgtccccagggactgctggcgcgcgccctgcaggatgcc
gcggtggacgccggcgaactcaacgccgcgttgcaagcgcggggcgagcatagtgcctcg
cgcaatccggtgttcgcgcccgagctggtgcagtggctgcaggatgcgctgttgctggcc
aacctcgaactgggccgtagccagatcgaccaggcggcattgatcctggccctgctacgc
aacccgttgcgctatgccggcagccgctaccagccgctgctggcgcggctcgacatcgag
cggttgaaggatttcgcgctctcgcagccgctggagggcgcgcccagcggcaagccgggc
ggcggcgagtccctgttgcagcgtttcacccacaaccttacccagcaggcgcgcgacggc
aagctcgatccggtgctctgtcgcgacggggctattcgccagatggtcgacatcctggcc
cgtcggcggaaaaacaaccccatcgtggtcggcgaggccggcgtcggcaagaccgccatc
gtcgaaggcctggcctcgcggatcgccgcaggggaagtgccgccggcgctgagggacgtc
gagctgttgtccctcgacatgggcctgttgcaggccggtgccagcgtgaagggcgagttc
gagcggcgcctgaaaggcgtcatcgacgaagtgaaggcagcgctcaggccgaccatcctg
ttcatcgacgaggcccatacgctgatcggcgcgggcggtcaggccggcggctcggatgcc
gccaacctgctcaagccggccctggcacgtggcgagttgcgcaccatcgcggcgacgacc
tgggccgaatacaagaagtatttcgagaaggacccggcgctggcccggcgcttccagccc
gtgcagttgcatgagccgagcgttgccgaggcggtgacgatcctgcgtggcttggcccgg
gtttacgaggaaagccacggtatctacctgcgcgacgacgcggtggtggccgccgccgaa
ctgtccgcccgctacctggcgggtcgccagttgccggacaaggccgtcgacgtcctcgac
accgcctgtgcgcgggtgcgcatcagcctggcggcggcgccggagagcctcgagcgcctg
cgcggcgagctggccgaaggcgagcgccagcgccaggccctgcgccgcgatgccgaggca
ggcctgccgatcgaccacgatgccctgcaggcgctggaggagcgcctggcccaggcggaa
agcgagcggcacgtacaggaggaccagtggagccgccagcgcgaactcgccgagcgcctg
ctcgccctgcgccagcaattggccagggcccgcgaggcgaaccgggaagagcagggcggc
gaggcggacgcggagactttcccggccgacgagcatggcggtgtcgaagccctggaaaag
gcccttcacgaaacccgccaggcgctcgccgatgcccaggcccaggggcggctggtcagc
ttcgaggtctgcccgcgcctggttgccgaggtgatcggcgcctggaccggcgtaccggtg
gaacaactggcgcgggaacacaacgccaaggtgatgggtttcgccgacgacctgcgggcg
cggatccgtggccaggaacaggcggtcagtgccctggaccgcgcgatgcgcgccaccgcg
gccgggctgaacaagcccgatgcgccggtcggcgtgttcctgctggtgggcccgagcggg
gtgggcaagaccgagaccgcgctggcgctggccgacctgctgtatggcggcgagcgtttc
atcaccaccatcaacatgtccgagttccaggagaagcacaccgtctcgcgcctgatcggc
gcgccgcccggctatgtcggctatggcgagggtggcatgctcaccgaggcggtacgccag
aagccctattcggtgatattgctggacgaggtggagaaggccgatccggacgtgctcaac
ctgttctaccagatcttcgacaagggcgtggccaacgatggcgaagggcgcgagatcgat
ttccgcaataccttgatcctgatgacctccaacctcgccagcgagcacatcgccgcgctt
tgccaggacggcgcgcggccttccgccgaactcctggaggaaaccatccggccggcgctc
agccggcatttcaagccggcgctgctggcgcgcatgcgcgtggtgccttactacccggtg
ggcggcccggtactgcgcgagctgatcgagatcaagctgcaacgcctcggcgagcgcctg
gcgcgccgtcaactggctttcgactacagccaggcgctggtgggccacctggccgagcgt
tgcacccagagcgacagcggcgcacggttgatcgaccacctgctggacacgcacctgctg
ccgctggtggccgaccgtttgctggaagcgatggcgcgcgacgagcgtctcgagcgggtc
catgcgacgctgggcgagcacggccgcgtgctctgcgagttcgcctga

DBGET integrated database retrieval system