KEGG   Pseudomonas aeruginosa M18: PAM18_3389
Entry
PAM18_3389        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paf00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_3389
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3389
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3389
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEO75872
Position
complement(3774161..3774667)
AA seq 168 aa
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRADERKVEDRKPIGIDKM
TFDEVLAKQELGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMEL
RDALVALKGPLGNAPAFRKAIESVLADDESRSRVLGELGLSAAPSQDA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcggtagccccaaaggaacgcatcaacgtcaccttcaagcccgcc
actggcggtgcccaggaagaaatcgaactgccgttgaagctactggcgatcggcgattac
acccagcgcgcggatgagcgcaaggtggaggaccgcaagccgatcggcatcgacaagatg
accttcgacgaggtcctggccaagcaggagctggggctgacgctgagcgtacccaatcgt
ctccaggaggagggcggcagcgacgagctggcggtggggctgcagatcaactcgatgaag
gacttcaacccggccagcatcgtcgagcaggtgcccgagctgaagaagctgatggagttg
cgcgatgcgttggtggccctcaagggcccgctgggcaacgccccggcgttccgcaaggcc
atcgaaagcgtactcgccgacgacgagtcccgtagccgtgtgctgggcgagctggggctg
agcgccgccccctcccaggacgcctga

DBGET integrated database retrieval system