KEGG   Pseudomonas aeruginosa M18: PAM18_3390
Entry
PAM18_3390        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paf02044]
    PAM18_3390
Secretion system [BR:paf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAM18_3390
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: AEO75873
Position
complement(3774703..3776259)
AA seq 518 aa
MTYSSKLSSHYLELAEQPISKDVFAGEDVRFSSEYEALENELGKALSLHENGQTDWLKIL
ENSEALLRAQSKDLRVAAWLTWALYQRESFPGLLAGLGLLERLCSRHWVEIHPLKARTRA
AAIAWLVPRLEQALNENVPIKEQLPLFRRLAEHLEKLDTALTAQLGDDAPLLLPISRRLS
GMLQRAADNQPEPGVVGAVVAQVKQAASQLLAPGAPIDNERDAHKAMRAQQEAARPLCAW
WLKQKATDLRALRLNRTMLWLPIESMPERNAEQVTALRGVPADKLKSYQERFAQGLYADL
LVELEASLARAPFWFDGQRLVWECLQGLNAEQAMREVEMHFALLLQRLPGLVELRFHDGS
AFADAATRGWISAHVMPHLQNDSAPRKVETVALQAEWDVALDEVQPVLRKDGLKAAVQVL
KQGMKRAHGGRARFFWQLSLARLCFLAKKYELAKTQLESLDHQLHESGLHAWEPDLALDV
LHLLHSCCELLPQNHAVRERKEDIYRRLCHLDLEVVLE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgacctattcgagcaagctctcctcgcattatctggaactcgcggaacagccgatttca
aaggatgtctttgcgggtgaggatgtgcgtttttccagcgaatacgaggcgctggaaaat
gagctgggcaaggcgctctcgctccatgagaacggccagaccgactggttgaaaatcctg
gaaaacagcgaagcgctgcttcgtgcccaatccaaggacctgcgtgttgcagcctggttg
acctgggccctctaccaacgggaatcctttcccggtttgctggccggactgggattgctg
gaacgtctgtgcagccggcattgggtcgagatccatccgctcaaggcgcgcactcgcgcc
gcggccattgcctggctggtgccccggctggagcaggcgctgaacgagaacgtaccgatc
aaggagcaactccccctgttccggcgtctcgccgagcacctggaaaaactcgataccgcg
ctgaccgcgcaactgggcgacgacgcgcccttgttgctgccgatcagccgacgcctttcg
ggcatgctccagcgcgccgccgacaaccagcccgaacctggcgtggtcggcgccgtggtg
gcccaggtcaagcaggcggccagccagttgctggcgccgggtgcgcccatcgacaacgag
cgcgacgcccacaaggccatgcgcgcccagcaggaggccgcacgccccctgtgcgcctgg
tggctgaagcagaaagccaccgatctgcgcgcgctgcgcctcaaccgaacgatgctctgg
ctgcccatcgagtccatgcccgagcgcaatgccgaacaggtcaccgcgctaaggggagtg
ccggcggacaagctgaaaagctaccaggagcgtttcgcccagggcctgtacgccgatctc
ctggtggagctggaggcgagcctggcacgggcgccgttctggttcgacggccagcgcctg
gtctgggagtgcctgcaagggctcaacgccgagcaggcgatgcgggaagtcgaaatgcat
ttcgccttgctcctgcagcgtctgccggggctggtggagctgcgtttccacgatggcagc
gcattcgccgatgcggccacccgcggctggatcagcgcccatgtcatgccccatctccag
aacgacagtgcgccgcgcaaggtcgagaccgtggccctgcaggccgaatgggacgtcgcc
ctggacgaggtccagccggtgttgcgcaaggacggcctgaaggcggcggtacaggtgttg
aagcagggcatgaagcgcgcccacggcgggcgcgcccggttcttctggcaactgagcctc
gcgcgactgtgcttcctggcgaagaagtacgagctggccaagacccagctggagagcctc
gaccatcagttgcacgaatcgggattgcacgcctgggagcccgatctggcgctggatgta
ctgcacctgctgcatagctgctgcgagctgttgccgcagaaccacgccgtgcgagaacgc
aaggaagacatttatcgcaggctgtgccacctcgatctcgaggtggtgctcgaatag

DBGET integrated database retrieval system