KEGG   Pseudomonas aeruginosa M18: PAM18_3392
Entry
PAM18_3392        CDS       T01973                                 

Definition
(GenBank) putative aminotransferase
  KO
K05825  2-aminoadipate transaminase [EC:2.6.1.-]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00300  Lysine biosynthesis
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PAM18_3392
Enzymes [BR:paf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     PAM18_3392
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_MocR HEAT_2
Other DBs
NCBI-ProteinID: AEO75875
Position
complement(3778089..3779255)
AA seq 388 aa
MAFSERISRLKSSLIREILAAAQRPEVMSFAGGLPAEPMLPKVQWEQMPASMGQYGMSEG
EPALREAIAAEARALGVPCEASQVLIVSGSQQTLDLASKLFIDPGTEVLLEAPTYLAALQ
AFQLFGADCVTVPLGAEGPDLVALRQRLERHKPAFAYLIPTFQNPSGVRYSEERRDAVAA
LLDEFGVTLIEDEPYRELVFDEGRATPLVSRLRKSSWIYTGTVSKTLLPGLRVGFLIATP
DLFPHLLRLKQSADLHTNRVGQWQALQWFGSEAYRQHLAELREFYRVRRDAMQEALLEHF
GELAEWNIPEGGLFFWLTLRQPLDTRTLLQPALAADVAFMPGEPFFAEPEQNLGRLRLNF
SHVAPERLHEGLRRLAKVVRDAQAAEAA
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggccttctctgaacgcatctcccgcctgaaaagctccttgatccgcgaaatccttgcc
gcggcgcagcgtccggaggtgatgtcgttcgccggcgggctgccggccgagccgatgctg
ccgaaggtgcagtgggagcagatgccggcctccatgggccagtacggcatgagcgaaggc
gagcctgccctgcgcgaagccatcgccgccgaagcgcgtgccctcggcgtcccctgcgag
gcgagccaggtgctgatcgtcagcggttcgcagcagaccctcgacctggccagcaagctg
ttcatcgatccgggcaccgaggtgctgctcgaggcgccgacctacctcgccgcgctacag
gccttccaattgttcggcgccgattgcgtgaccgtgccgctgggtgccgagggccccgac
ctggttgccctgcggcagcgcctggagcgacacaagccggccttcgcctacctgatcccg
actttccagaatccgtccggcgtgcgctacagcgaggaacgccgcgacgcggtggcggcg
ctgctagacgaattcggcgtgaccctgatcgaagacgaaccctatcgcgaactggtgttc
gacgagggccgcgcaaccccgctggtcagccgcctgcgcaagtccagctggatctatacc
ggcacggtgtcgaagaccctgctgccgggcctgcgcgtcggtttcctgatcgccaccccg
gacctgttcccccacctgctgcggctgaaacagtcggccgacctgcataccaaccgggta
gggcagtggcaggcgctgcaatggttcggcagcgaggcctaccgccagcacctggccgaa
ctgcgcgagttctaccgggtccgccgcgacgccatgcaggaggcgctgctggagcacttc
ggtgagctggccgaatggaatatcccggagggcgggctgttcttctggctgaccctcagg
cagccgctggatacccgcaccctgctccagccggcgctggccgccgatgtcgcattcatg
cccggcgaacctttcttcgccgagccggagcagaatctcgggcgtctgcggctgaacttc
agccacgtcgccccggagcgcctgcacgaaggcctgcggcgcctggccaaggtcgtccgc
gacgcccaggccgccgaagcggcctga

DBGET integrated database retrieval system