KEGG   Pseudomonas aeruginosa M18: PAM18_3393
Entry
PAM18_3393        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: MarR_2 MarR HTH_27 HTH_24 HTH_20
Other DBs
NCBI-ProteinID: AEO75876
Position
3779337..3779813
AA seq 158 aa
MPDLKNHAVQQQAMMEAFFFAYQAFTTKPDEMLARRGLGRVHHRVLFFIARYPGLSVKEL
LALLGVTKQALNIPLRQLLEMNLIGSATADDDKRKRLLGLTAEGVRLEKALRREQSRLLQ
RCFEEAGGEAVSGWLAVNRTLARAHAGSRGEAATEAAD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgcctgacctgaaaaaccacgccgtccagcagcaggccatgatggaagccttcttcttc
gcgtaccaggccttcaccaccaagcctgacgagatgctcgcccgccgcggcctgggacgt
gtgcaccaccgcgtgctgttcttcatcgcccgctatccgggcctcagcgtgaaggaactg
ctggccctgctcggcgtgaccaagcaggcgctgaacatcccgctgcgccagttgctggag
atgaacctgatcggcagcgccaccgccgacgacgacaagcgcaaacgcctcctcggcctc
accgccgagggcgtgcggttggaaaaggcgctgcgtcgcgagcagtcgcggctgctccaa
cgctgcttcgaggaagccggcggcgaagcggtctccggctggctggcggtcaatcgcacc
ctggctcgggcgcatgcaggcagccgcggcgaagcggcgacggaggccgccgactga

DBGET integrated database retrieval system