KEGG   Pseudomonas aeruginosa M18: PAM18_3394
Entry
PAM18_3394        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DUF4282
Other DBs
NCBI-ProteinID: AEO75877
Position
complement(3779863..3780498)
AA seq 211 aa
MDANPYATPRVELVEQGIPDAFRRRWTPAQLRILAWLCLASIAGGVVLMVLSLLEAFGDG
AAFRVYADWLGLLLSLLGAYLLLRLKHLVESRFRGPSLAWPVWLSILLTLLGEGWSLLAV
TDDALQGWNWQALVYFALLALIGATTLWLGLRLLKQENLYPSLRIMAWLDIAGGAMLASV
LLLVLAVLPLLAATVAMALACWRAARELERS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggatgcaaacccctacgccacgccgcgtgtcgaattggtcgagcagggcataccggat
gctttccgccggcgctggacgcccgcgcaactgcgcatcctcgcctggctctgcctggcc
tcgatagccggcggcgtggtgctgatggtgctcagcctgctggaggcattcggcgacggc
gccgcgttcagggtctacgccgactggctgggcctgctcctcagcctgctcggcgcctac
ctgctgctgcggctcaagcacctggtcgagtcgcgctttcgcggcccctcgctggcctgg
ccggtatggttgtcgattctcctgaccctgctgggcgagggctggagcctgctggcggtt
accgacgatgcgctgcagggctggaactggcaggcgctggtgtacttcgcgctgcttgcg
ctgatcggcgctaccaccctctggctgggcctgcgtctgctcaagcaggaaaatctctat
ccgtcgctgcggatcatggcctggctggacatcgccggcggcgcgatgctggcttcggtg
ctgttgctggtgctggcggtactgccgctgctggccgccaccgtggccatggcgctggcc
tgctggcgcgcggcgcgggagttggagcggagctag

DBGET integrated database retrieval system