KEGG   Pseudomonas aeruginosa M18: PAM18_3395
Entry
PAM18_3395        CDS       T01973                                 

Definition
(GenBank) putative transporter
  KO
K05782  benzoate membrane transport protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paf02000]
    PAM18_3395
Transporters [BR:paf02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PAM18_3395
SSDB
Motif
Pfam: BenE
Other DBs
NCBI-ProteinID: AEO75878
Position
3780729..3781925
AA seq 398 aa
MTETTQPQPRLRPFADSSPAAVVAGFVAMLTGYTSSLVLMFQAGQNAGLSSAQISSWIWA
LSIGMGLATIGLTLRYRVPIVIAWSTPGAALLISSLPGVPYSEAIGAFIVCALLITLCGV
TGSFERLMRQVPSSLASALLAGVLFRIGIEICNAAEQQTLLVLAMFFSYLLCKRFSPRYA
VFAALLVGVLLAGILGQLDFSRFRLELAVPEWTTPSFSLAATISIGIPLFIVAMASQNMP
GIAVLRADGYQVPASPLISSTGIASILLAPFGSHGINLAAISAAICTGPSAHEDPHKRYT
AALWCGFFNCVAGTFGATLAALFAAFPKALVLSIAAIALLGSIMNGLANSMADERQREAA
LVTFMVTASGFTLLSIGSAFWGLVAGLLTQFVLNWRRG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaccgaaaccacccagccccagcctcgtctgcgtccgttcgccgactcctctcccgcc
gccgtggtggccggcttcgtcgccatgctcaccggctacaccagctcgctggtactgatg
ttccaggctgggcagaacgccggtctcagcagcgcgcagatttcctcgtggatctgggcc
ctgtcgatcggcatgggcctggcgaccatcggcctgaccctgcgctaccgggtgccgatc
gtgatcgcctggtccacccccggcgcggcgctgctgatcagcagcctgcccggagtgccg
tacagcgaggcgatcggcgccttcatcgtctgcgccctcctgatcaccctgtgcggcgtc
accggcagcttcgaacgcctgatgcgccaggttccctcctcgctggcctcggcgctgctg
gccggggtgctgttccgcatcggcatcgagatctgcaacgccgccgagcaacagaccctg
ctggtgctggcgatgttcttcagctatctgctgtgcaaacgcttctcgccgcgctatgcg
gtgttcgctgcgctactggtgggggtgctgctggccgggatactgggccaactggacttc
agcaggttccgcctggaactggcggtaccggagtggaccacgccgagcttctccctggcc
gccaccatcagcatcggcatcccgctgttcatcgtcgccatggcttcgcagaacatgccc
ggcatcgccgtgctgcgcgccgacggctaccaggtgccggcctcgccgctgatctcgagt
accggcatcgcctcgatcctgctggcaccgttcggctcccacgggatcaacctggcggcg
atcagcgcggcgatctgcaccggtccctcggcccacgaggacccgcacaagcgctatacc
gcggcgctctggtgcggcttcttcaactgcgtcgcaggaaccttcggcgccaccctggca
gcgttgttcgcggcgttccccaaggcactggtactgtccatcgccgccatcgccctgctc
ggctcgatcatgaacggcctggccaactcgatggccgacgagcgccagcgcgaggccgcg
ctggtgaccttcatggtcaccgcctccggcttcaccctgctgtccatcggctcggcgttc
tggggcctggtggccggcctgctgactcagttcgtgctcaactggcggcgcggctga

DBGET integrated database retrieval system