KEGG   Pseudomonas aeruginosa M18: PAM18_3396
Entry
PAM18_3396        CDS       T01973                                 

Definition
(GenBank) putative transporter
  KO
K03453  bile acid:Na+ symporter, BASS family
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PAM18_3396
SSDB
Motif
Pfam: SBF SBF_like
Other DBs
NCBI-ProteinID: AEO75879
Position
complement(3781932..3782825)
AA seq 297 aa
MTADPILTLFLPIALGIIMLGLGLSLTPADFLRVVRYPKPVLVGLVCQIVLLPLACFLIV
QGFALEAALAVGMMLLAASPGGTTANLYSHLAHGDVALNITLTAVNSVIAILTMPLIVNL
SLQYFMGDGQAIPLQFGKVVQVFVIVLGPVAIGMLVRNRLPAVADRLQKPVKILSALLLL
VIILLALAKDWQTFVTYAPVVGLAALAFNLLSLAVGYWVPRLLRLPKAQAVAIGMEIGIH
NGTLAIALALSPSLLNNSTMAIPPAIYGVLMFFTAAAFGWWVSRGHQAAPAPVTAPD
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaccgccgatcccatcctgaccctgttcctccccatcgcactgggcatcatcatgctc
ggtctcggactgtccctgaccccggccgacttcctccgcgtggtgcgctacccgaagccg
gtgctggtcggcctggtgtgccagatcgtcctgctgcccctggcctgtttcctgatcgtc
cagggcttcgccctggaggcggccctggcggtcggcatgatgttgctggcggcctcgccc
ggcggcaccaccgccaacctctacagccacctggcgcatggcgacgtggcactgaacatc
accctgaccgcggtgaactcggtgatcgccatcctcaccatgccgctgatcgtcaatctg
tcgctgcaatacttcatgggcgacgggcaggcgattcccttgcagttcggcaaggtcgtg
caggtcttcgtcatcgtcctcggcccggtggccatcggcatgctggtgcgcaaccgcctg
ccggccgtggcggatcgcctgcagaagccggtgaagatcctttccgcgctgctgttgctg
gtgatcatcctgctggcgctggccaaggactggcagaccttcgtcacctacgcgccggtg
gtcgggctggccgcgctggccttcaacctgctgagcctggcggtgggctactgggtgccg
cgcctgctgcgcctgccgaaggcccaggcggtggccatcggcatggagatcggcatccac
aacggcaccctggcgatcgccctggcgctgagtccgagcctgctgaacaacagcaccatg
gcgattccgccggcgatctacggagtgctgatgttcttcaccgcggcggccttcggctgg
tgggtcagccgtggccaccaggccgcgccggcgcccgtgacggcgccggactga

DBGET integrated database retrieval system