KEGG   Pseudomonas aeruginosa M18: PAM18_3397
Entry
PAM18_3397        CDS       T01973                                 

Definition
(GenBank) short chain dehydrogenase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: AEO75880
Position
complement(3782984..3783745)
AA seq 253 aa
MSKLLSGQVALVTGGAAGIGRATALAFAAAGVKVVVADLDSAGGEGTVEAIRQAGGEAVF
IRCDVTRDAEVKALVEGCAAAYGRLDYAFNNAGIEIEQGKLADGNEAEFDAIMAVNVKGV
WLCMKHQIPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKGI
RVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPLGRVGRVEEIAAAVLYLCSDNAGFTT
GIALPVDGGATAI
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagcaaacttctttccggccaggtcgcactggtcactggcggtgcggcgggcatcggc
cgcgctaccgcgctggccttcgccgccgccggggtcaaggtggtggtcgccgacctggac
agcgccggcggcgagggcacggtcgaagcgatccgccaggcgggaggcgaagccgtcttc
attcgctgcgacgtcacccgcgacgccgaggtcaaggcgctggtagagggttgcgcggcg
gcctacggccgtctcgactacgccttcaacaacgccggtatcgagatcgagcagggcaag
ctggccgacggcaacgaagccgagttcgacgccatcatggctgtcaacgtgaagggcgtc
tggttgtgcatgaagcaccagatcccgctgatgctggcccagggcggtggcgcgatcgtc
aacaccgcctcggtcgccgggctcggcgcggcgccgaagatgagcatctacgctgcttcc
aagcacgcggtgatcggcctgaccaaatcggcggcgatcgagtacgcgaagaagggcatc
cgcgtcaacgccgtgtgtccggcggtgatcgacaccgacatgttccgccgcgcctacgag
gccgatccgcgcaaggccgagttcgccgccgcgatgcatccgctgggtcgggtcgggcgg
gtcgaggaaatcgccgccgcggtgctctatctgtgcagcgacaacgcaggcttcaccacc
ggtatcgccttgccggtggacggcggggcgacggcgatctga

DBGET integrated database retrieval system