KEGG   Pseudomonas aeruginosa M18: PAM18_3398
Entry
PAM18_3398        CDS       T01973                                 

Definition
(GenBank) putative oxidoreductase
  KO
K23256  NADPH-dependent curcumin reductase [EC:1.3.1.-]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAM18_3398
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     PAM18_3398
SSDB
Motif
Pfam: ADH_N_2 ADH_zinc_N ADH_zinc_N_2 PhoH
Other DBs
NCBI-ProteinID: AEO75881
Structure
PDB: 
4B7C 4B7X

Position
3783996..3785000
AA seq 334 aa
MTSQINRQYQLAQRPSGLPGRDTFSFVETPLGEPAEGQILVKNEYLSLDPAMRGWMNDAR
SYIPPVGIGEVMRALGVGKVLVSKHPGFQAGDYVNGALGVQDYFIGEPKGFYKVDPSRAP
LPRYLSALGMTGMTAYFALLDVGQPKNGETVVISGAAGAVGSVAGQIARLKGCRVVGIAG
GAEKCRFLVEELGFDGAIDYKNEDLAAGLKRECPKGIDVFFDNVGGEILDTVLTRIAFKA
RIVLCGAISQYNNKEAVRGPANYLSLLVNRARMEGMVVMDYAQRFPEGLKEMATWLAEGK
LQSREDIVEGLETFPETLLKLFSGENFGKLVLKV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacctcccagatcaatcggcaataccagttggcccagcgtcccagcgggctgcccggc
cgcgacaccttcagtttcgtcgaaaccccgctcggcgaaccggccgagggccagatcctg
gtgaagaacgagtacctgtcgctggacccggcgatgcgcggctggatgaacgacgcccgc
tcctacatcccgccggtggggatcggcgaggtgatgcgtgcgctcggcgtcggcaaggtg
ctggtttcgaagcaccccggcttccaggccggcgactacgtcaacggcgccctcggcgtg
caggactatttcatcggcgagcccaagggtttctacaaggtcgacccgtcccgcgcgccg
ctgccacgctatctctcggcgctgggcatgaccggcatgaccgcctacttcgcgttgctc
gacgtcggccagccgaagaacggcgagaccgtggtgatctccggcgccgccggtgcggtg
ggcagcgttgccgggcagatcgccaggctcaagggctgccgggtggtgggcatcgccggc
ggcgccgagaaatgtcgcttcctggtcgaagaactgggcttcgacggcgccatcgactac
aagaacgaagacctcgccgccggactcaagcgcgaatgcccgaagggtatcgatgtgttc
ttcgacaacgtcggcggcgaaatcctcgacacagtgctcacccgcatcgccttcaaggca
cgcatcgtcctctgcggggcgatcagccagtacaacaacaaggaagcggtgcgcggcccg
gccaactacctgtcgctgctggtcaatcgggcgcgcatggaaggcatggtggtgatggac
tatgcccagcgcttcccagaaggcctgaaggagatggccacctggctggcggaaggcaag
ctgcaatcgcgcgaggacatcgtcgaaggcctggagaccttccccgaaacgctgctcaag
ctgttcagcggggaaaacttcggcaagttggtgttgaaggtctga

DBGET integrated database retrieval system