KEGG   Pseudomonas aeruginosa M18: PAM18_3399
Entry
PAM18_3399        CDS       T01973                                 

Definition
(GenBank) putative sulfate transporter
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: AEO75882
Position
3785143..3786864
AA seq 573 aa
MPLARWVPGLDSLLHYRRAWFRPDVQAGLSVAAIQIPTAIAYAQIAGFPPQVGLYACILP
MLIYALIGSSRQLMVGPDAATAAMVAAAITPLAAGDPQRLVDLSMIVAIMVGLFSIVAGL
ARAGFIASFLSRPILVGYLNGIGLSLLVGQLGKLFGYEAATSGFVAGILALLENLLHIHW
PTLILGSLSLLLMVLLPRRFPQLPGALCGVLLASLAAALLGLDRYGVELLGEVPAGLPQL
SWPQTSLEELKSLLRDATGITVVSFCSAMLTARSFAARHGYSINPNHEFVALGLANIGAG
VSQGFAISGADSRTAVNDMVGGKTQLVGVVAALVIAATLLLLNKPLGWVPMPALGAVLLL
AGWGLIDVQALKGFWKLSRFEFSLCLLTTVGVLSVGVLPGIFVAVSIAVLRLLYYTYRPS
DAVLGWMHGIDGQVELAKYPQATTLPGLVIYRFDAPLLFFNADYFKQRVLAVVDGSERPN
AVLLNAEAMTNLDISGLATLHEVQQILKAQGVHLSLARVTGQTLDLLQRSSMLGEIKPPL
VFSSVRSGVSAYRYWLRQQERLAAQAAATSGNA
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgccactcgcccgctgggtacccggactcgatagcctgctccactaccgccgcgcctgg
ttccgtccggatgtccaggccgggctgtcggtagcggcgatccagatccccaccgccatc
gcctacgcccagatcgccggcttcccgccccaggtaggcctctatgcgtgcatcctgccg
atgctgatctacgccctgatcggcagctcgcggcagttgatggtaggccccgacgcggcg
accgcggcgatggtcgccgccgccatcaccccgctggcggcgggcgatccgcagcgcctg
gtggacctgtcgatgatcgtcgcgatcatggtcgggctgttctccatcgtcgccggcctg
gcccgcgccgggttcatcgccagcttcctctcgcgaccgatcctggtcggctacctcaac
ggcatcggcctgagcctgctggtcgggcaactgggcaagctgttcggctacgaggcggcg
accagcggcttcgtcgccggcatcctcgcgctgctggagaacctgctgcacatccattgg
ccgacgctgatcctcggcagcctctcgctcttgctgatggtgctgctgccgcggcgcttc
ccgcagttgcccggggcgctctgcggcgtcctcctggccagcctcgccgcggcgctgctg
ggcctggatcgctacggcgtggaactgcttggcgaggtaccggccgggctgccgcaactg
agctggccgcagaccagcctggaggaactgaaaagcctgctgcgcgacgccaccggcatc
acggtggtcagcttctgcagcgccatgctcaccgcgcgcagcttcgccgcccgtcacggc
tacagcatcaaccccaaccacgaattcgtcgccctcggcctggccaacatcggcgccggg
gtctcccagggcttcgccatcagcggcgccgactcacgcaccgcggtgaacgacatggtc
ggcggcaagacccaactggtcggcgtggtcgccgcgctggtgatcgccgccaccctgttg
ctgctgaacaagcccctgggctgggtgccgatgccggcgctcggcgcggtcctgttgctg
gccggctggggcctgatcgacgtacaggcgctgaagggcttctggaagctcagccgcttc
gagttcagcctctgcctgctgaccaccgtcggcgtgctcagcgtcggcgtgctgccggga
atcttcgtcgccgtcagcatcgccgtactgcgcctgctctactacacctatcgcccgagc
gacgcggtgctcggctggatgcacggcatcgacggccaggtcgagctggccaagtacccg
caggccaccactcttcccggcctggtgatctaccgcttcgacgcccccctgctgttcttc
aacgccgactacttcaagcagcgggtgcttgccgtggtggacggcagcgagcggccgaat
gcggtgctgctcaacgccgaagccatgaccaacctcgacatcagcggcctggccaccctc
cacgaggtgcaacagatcctcaaggcccagggcgtgcacctgtcgctggcgcgggtgacc
gggcagacgctggacctgctgcaacgctcgagcatgctcggcgagatcaagccgccgctg
gtgttcagctcggtgcgctccggggtcagtgcctatcgctactggctgcgccagcaggaa
agactcgccgcccaggccgcggctacaagcggaaatgcctga

DBGET integrated database retrieval system