KEGG   Pseudomonas aeruginosa M18: PAM18_3400
Entry
PAM18_3400        CDS       T01973                                 

Definition
(GenBank) putative chemotaxis transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
paf02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3400
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PAM18_3400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:paf02035]
    PAM18_3400
Bacterial motility proteins [BR:paf02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    PAM18_3400
SSDB
Motif
Pfam: MCPsignal HAMP HBM DUF3450 PG_binding_1 CREPT
Other DBs
NCBI-ProteinID: AEO75883
Position
complement(3786845..3788803)
AA seq 652 aa
MLGLLRRRLADLGTAKKLAIGFTLVLLLTALVAALAVLSLHALGQRFARLQEMSAINRDV
LEVRQAEKEFALHGEKSDAERLRQRLAATLERVGRLKADGDADQALGMAEVEQVLAAYLE
AFGRFEQSIQGRQLAWESASWSLNGAANSLDILQSSLAEDGAYALKESQGHDGEPLLQQA
AQVAQVNRLVLQGLDEARSRLEARAADAQEGPPKSLREALELAARLEQAITDDAYVSVVK
DVLTNIRGFADKLAEYRASQLQERQMYAAMGERAGQVMARVDRSWEAQQQAMLHSLRTNS
LLIVGAAVLALLVGLGAAFGISLLIVRPLRQAMGVAQRIAEGDLAVRVDSERRDEVGQLM
AAMRAMTGSLRGIVSQLQDGVGRIAGASEALSGVTTRTRLGIDSQRAETEQVATAMNQMA
ATVHEVAHNAEEAAGAAESADGKVSVGQEVVRQTLERIERLAEAVRAATASVEALSADSQ
RIGSVLDVIKSVAEQTNLLALNAAIEAARAGDQGRGFAVVADEVRALARRTQQSTAEIET
LIGALQNGTQQAVQRMQRSHQLVDQSVDDALQTEAALGNIATAVALIQQMNQQIAAASEQ
QSAVAEEINRSVTAIREVADQSAQAMQSTASSSEQLAELGRELQGMVRHFRL
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgctggggttgctgcgcaggcgtctggccgatctcggcacggcgaagaaactggccatc
ggttttaccctggtcctgctattgaccgcgctggtggccgcgctcgcggtgctctcgctg
catgcgctggggcagcgcttcgcgcgcctgcaggagatgagcgcgatcaatcgcgacgtg
ctggaggttcgccaggccgagaaggaatttgccctgcacggggaaaagagcgacgccgag
cgcttgcgccagcgcctggccgcgacccttgaacgggtgggccggctcaaggccgacggc
gacgccgatcaggcgcttggcatggccgaggtggagcaggtgctggcggcatacctagaa
gcgttcggccgcttcgagcagtccatccagggacgccaattggcttgggaaagcgccagt
tggtcgctgaacggcgccgccaacagcctcgatatcctccagtccagcctggccgaggat
ggcgcctatgcgctgaaggagagccaggggcacgacggcgagccgctgttgcagcaggcg
gcccaggtcgcccaggtcaatcgcctggtccttcaggggctggacgaggcccgctcgcgt
ctcgaagcgcgcgccgcggatgcgcaggaggggccgccgaaatcgctgcgcgaggcgctg
gagctggcagcccggctggagcaggcgatcaccgacgatgcctacgtgtcggtggtcaag
gacgtgctgaccaatatccgcggtttcgccgacaagctcgccgagtaccgcgccagtcag
ctccaggagcggcagatgtacgccgccatgggcgagcgcgccgggcaggtgatggcgcgt
gtcgaccgtagctgggaggcgcagcagcaggccatgctccacagcctgcggacaaactcc
ctgctgatcgtcggcgccgccgtgctggcgctgctggtgggcctgggcgcggccttcggc
atcagcctgctgatcgtccgtccgctgcgccaggcgatgggtgtggcgcagcggatcgcc
gaaggcgaccttgcggtacgggtcgacagcgagcggcgcgacgaggttggccaactgatg
gccgcgatgcgcgccatgaccggcagcctgcgcggtatcgtcagccagttgcaggacggc
gtcgggcggattgccggcgcttccgaggcgctgtccggcgttaccacgcgcacccgcctg
ggaatcgacagccagcgggcggaaactgaacaggtggccacggcgatgaaccagatggcc
gccaccgtccatgaagtggcgcacaacgccgaggaagccgcgggggcggcggaaagcgcc
gacggcaaggtcagcgtcggccaggaggtggtacgccagaccctggagcggatcgagcga
ctggccgaggcggtgcgcgcggccaccgccagcgtcgaggcgctgagcgccgacagccag
cgcatcggcagcgtgctggacgtgatcaagagtgtggccgagcagaccaacctgctggcg
ctgaacgccgccatcgaggcggcgcgggccggcgaccagggtcgaggcttcgccgtggtc
gccgacgaggtgcgggcgctggcgcggcgcacccaacagtccacggccgagatcgagacc
ctgatcggtgccttgcagaatggcacgcagcaggcggtgcagcgtatgcagcgcagccac
cagttggtggaccagagcgtcgacgacgcgttgcagaccgaggcggcgctgggcaacatc
gctacggcggtggcgctgatccagcagatgaaccagcagatcgccgcggcctccgagcag
cagagcgcggtcgccgaggagatcaaccgcagcgtcacggcgatccgcgaggtggccgat
cagtcggcccaggccatgcagtcgacggcttcgtccagcgaacaactggcggagttgggc
cgcgaactacagggcatggtcaggcatttccgcttgtag

DBGET integrated database retrieval system