KEGG   Pseudomonas aeruginosa M18: PAM18_3401
Entry
PAM18_3401        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DUF5086
Other DBs
NCBI-ProteinID: AEO75884
Structure
PDB: 
2XU8

Position
3789004..3789411
AA seq 135 aa
MRPVLPLLLSLSLCAPALADWSGPIEQPLWSLPAAPGLSRWLIVHNLSSAAADGLYHVEV
LERRQGQQPWQFQRLAAHLALTEQALRASIVAPLKRGGVYPESYQFAYRQWQERQAAGQA
PVCRRTVDECLRAPD
NT seq 408 nt   +upstreamnt  +downstreamnt
atgcgtcccgtattgccgctgttgctgtcgctgagtctgtgcgcccccgccctggccgac
tggagcggcccgatcgagcagccgctctggtcgttgccggcggcgccgggcctgtcgcgc
tggctgatcgtgcacaacctgtcgagcgcggcggccgacggcctgtaccacgtcgaggtc
ctggagcgccgccagggccagcagccctggcagttccagcgcctggccgcgcacctggcg
ctgaccgaacaggcgctgcgcgcgagtatcgtggcgccgctgaagcgcggcggggtgtat
ccggaaagctaccagttcgcctatcgccagtggcaggaacgccaggccgcgggccaggcg
ccggtgtgccggcgcacggtcgacgagtgcctgcgggcgccggactga

DBGET integrated database retrieval system