KEGG   Pseudomonas aeruginosa M18: PAM18_3402
Entry
PAM18_3402        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: AEO75885
Position
complement(3789418..3790026)
AA seq 202 aa
MQLDFTTIAPAEAYRWLASTVTPRPIAWVSTLSAEGASNLAPFSFFQVISDEPPTLMVNV
SLRDDGSLKDTLRNVQATGQLVIHLVGAAQAETMNATSAWLPHGVSEIETVGIPTVSSVR
VAPPRIAAAAVAFECEVAEIKPYPAENPNCHLIFARVLLAHVDDAVLADERHVDSARLDL
VGRLGGSHYSHTRDTFSMIRPR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcaactggacttcaccaccatcgctcccgccgaggcctatcgctggttggcttccacc
gtcaccccgcgaccgattgcctgggtctcgaccctgtccgccgagggcgccagcaacctg
gccccgttcagcttcttccaggtgatcagcgacgagccgccgaccctgatggttaacgtc
agcctgcgcgacgacggcagcctcaaggacaccctgcgcaacgtccaggccaccgggcag
ttggtgatccacctggtcggcgccgcccaggccgagaccatgaacgccacctccgcctgg
ctgccccatggtgtgagcgagatcgagacggtcggcatccctaccgtgtccagcgtacgc
gtggcgccgccgcggatcgccgcggcggcggtggccttcgagtgcgaggtggcggagatc
aagccgtatccggcggagaaccccaattgccacctgatcttcgcccgcgtgctgctggcc
catgtcgacgatgccgtgctggccgacgagcgccatgtggatagcgcccggctcgacctg
gtcggtcgcctgggcggcagccactacagccatacccgcgacacgttcagcatgatccgg
cccaggtag

DBGET integrated database retrieval system