KEGG   Pseudomonas aeruginosa M18: PAM18_3403
Entry
PAM18_3403        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: GFA
Other DBs
NCBI-ProteinID: AEO75886
Position
3790164..3790511
AA seq 115 aa
MNYRGSCHCGTIAYEVEGDLDQVIQCNCSLCSRRGWLLWFVPRDRLALKTPASAMHTYTF
NTHRLQHHFCPTCGCAPFSEGIGPDGQAMAAVNARCLEDIDANALPVQHYDGRNA
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaactatcgaggaagctgccactgcggaaccatcgcctacgaagtcgaaggcgacctc
gaccaggtgatccagtgcaactgttcactgtgcagccggcgcggctggctgctgtggttc
gtcccgcgcgaccgtctggcgctgaagacgccggccagcgcgatgcacacctacaccttc
aacacccaccgcctgcagcatcacttctgccccacctgcggctgcgcgccgttcagcgaa
ggcataggtccggacggccaggcgatggccgcggtcaacgcgcgctgcctggaggacatc
gacgccaacgcgctcccggtacagcactacgatggccgcaacgcctga

DBGET integrated database retrieval system