KEGG   Pseudomonas aeruginosa M18: PAM18_3404
Entry
PAM18_3404        CDS       T01973                                 

Definition
(GenBank) tRNA 2-selenouridine synthase
  KO
K06917  tRNA 2-selenouridine synthase [EC:2.9.1.3]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paf03016]
    PAM18_3404
Enzymes [BR:paf01000]
 2. Transferases
  2.9  Transferring selenium-containing groups
   2.9.1  Selenotransferases
    2.9.1.3  tRNA 2-selenouridine synthase
     PAM18_3404
Transfer RNA biogenesis [BR:paf03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    PAM18_3404
SSDB
Motif
Pfam: AAA_18 AAA_16 Rhodanese Zeta_toxin AAA_22
Other DBs
NCBI-ProteinID: AEO75887
Position
complement(3790490..3791599)
AA seq 369 aa
MRDNTQHYRELFLDDIPLMDVRAPVEYHKGAFPNTVNRPLMNDIERQKVGTSYKQHGQQA
AIALGHELVCGALKAERLAAWKAFAEANPNGYLYCFRGGLRSQIVQQWLKQDAGIDYPRV
IGGYKALRNFLFETTRAAVDECDFVLVGGLTGCGKTEVIAALDNSLDLEGHANHRGSSFG
RRATPQPAQIDFENRLAIDILKKRHRGVGQFVLEDEGRIVGSCSLPLELYQGMQSYPLVW
LEDAFEQRVERILRDYVIDLRSEFERVVGVEEGFAAFSAYLQKSLAGIVKRLGGERYQRL
AAILVQALEEQGRDGSVDTHRGWIEGLLKEYYDPMYAFQRQSKEDRVEFRGNQAEVIGYL
RQRQALRPS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgcgcgacaacacccagcactaccgcgaactgtttctcgacgatatccccctgatggat
gtgcgcgccccggtggagtaccacaagggcgcctttcccaacactgtcaaccggccgctg
atgaacgacatcgagcggcagaaggtcggcaccagctacaagcagcacggccagcaggcc
gccatcgcccttggccacgaactggtctgcggggcgctcaaggccgaacggctggcggcc
tggaaagccttcgccgaagccaacccgaacggctacctgtattgcttccgcggcggcctg
cgctcgcagatcgtccagcagtggctgaagcaggacgccggcatcgactacccacgggtg
atcggcggctacaaggcgttgcgcaacttccttttcgaaaccacccgcgcggcggtcgac
gagtgcgatttcgtgctggtcggcggcctcaccggttgcggcaagaccgaggtgatcgcg
gcgctggacaacagcctcgatctcgaaggccacgccaaccatcgcggctccagctttggc
cggcgagccacgccgcagccggcgcagatcgacttcgagaaccgcctggccatcgacatc
ctgaagaagcgtcatcgtggcgtcggccagttcgtcctcgaggacgaggggcggatcgtc
ggcagctgctccttgccgctggagctgtaccagggtatgcagagttacccgctggtctgg
ctggaggatgccttcgagcagcgtgtcgagcgtatcctcagggactacgtgatcgatctg
cgcagcgagttcgagcgcgtggtgggcgtggaggagggcttcgccgccttctccgcctac
ctgcagaagagcctcgccggcatcgtcaagcgcctcggcggcgagcgctaccagcggctg
gcggcgatcctcgtgcaggcgctggaagagcagggccgcgacggctcggtggatacccat
cgcggctggatcgaggggctgctcaaggagtactacgacccgatgtacgccttccagcgg
cagagcaaggaagaccgcgtcgagttccgcggcaaccaggccgaggtgatcggctacctg
cgccagcgtcaggcgttgcggccatcgtag

DBGET integrated database retrieval system