KEGG   Pseudomonas aeruginosa M18: PAM18_3405
Entry
PAM18_3405        CDS       T01973                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00450  Selenocompound metabolism
paf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PAM18_3405 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paf03016]
    PAM18_3405 (selD)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     PAM18_3405 (selD)
Transfer RNA biogenesis [BR:paf03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    PAM18_3405 (selD)
 Prokaryotic type
    PAM18_3405 (selD)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-ProteinID: AEO75888
Position
complement(3791599..3792633)
AA seq 344 aa
MSEAIRLTQYSHGAGCGCKISPKVLEVILAGSGAQNLDPKLWVGNASRDDAAVYALDEER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLAAEVAREV
IAGGRKVCEEAGIPLAGGHSIDAPEPIFGLAVTGVVEKRFMKRNDTAEAGCRLYLTKPLG
IGILTTAEKKARLRAEDVGVARDWMCTLNRPGARFGRLAGVKAMTDVTGFGLLGHLVEMA
DGSKLTARVEYAAVPRLASAEYYLEQGCVPGGTLRNFDSYGERIAPLPEVQKLLLCDPQT
SGGLLVAVAPEGEAEFLAVAAELGLQLAPIGELVERQSLAVQVL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagcgaggcgatccgcctgacccagtacagccacggcgccggctgcggctgcaagatt
tcgcccaaggtactggaggtgatcctcgccggcagcggcgcgcagaacctcgatccgaag
ctctgggtcggcaacgcctcgcgcgacgacgcggctgtctacgccctcgacgaggagcgc
ggggtggtctccaccaccgatttcttcatgccgatcgtcgacgaccccttcgatttcggc
cgtatcgccgcgaccaacgccatcagcgatatctacgccatgggcggcgacccgctgatg
gccatcgccatcctcggctggccggtcaacgtgctggccgcggaagtcgcccgcgaggtg
atcgccggcggccgcaaggtctgcgaggaagccggcatcccgctggccggcggacactcc
atcgacgcccccgagccgatcttcggcctggccgtgaccggcgtggtggagaagcgcttc
atgaaacgcaacgacaccgccgaggccggctgcaggctgtacctgaccaagccgctgggc
atcggcatcctcaccactgccgagaagaaggccaggctgcgcgccgaggacgtcggcgtg
gcgcgtgactggatgtgcaccctgaacaggcccggcgcgcgcttcggccggttggcgggg
gtcaaggcgatgaccgacgtcaccggtttcggcctgctcggccacctggtggaaatggcc
gacggcagcaagctcaccgcacgcgtggagtacgccgcggtaccgcgcctggccagtgcc
gaatattatctggagcagggctgcgtgcctggcggcaccctgcgcaacttcgacagctat
ggcgagcgcatcgcgccactgccggaagtgcagaagctgttgctttgcgatccgcagacc
agcggcggcctgctggtggcggtggctccggaaggcgaggcggagttcctcgccgtggcg
gcggaactcggcctgcaactggcgccgatcggcgagctggtcgagcgacagagtctcgcg
gtacaggtgctgtaa

DBGET integrated database retrieval system