KEGG   Pseudomonas aeruginosa M18: PAM18_3407
Entry
PAM18_3407        CDS       T01973                                 

Definition
(GenBank) putative esterase
  KO
K07001  NTE family protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    PAM18_3407
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-ProteinID: AEO75890
Position
3793110..3794147
AA seq 345 aa
MSKQVALVLGSGGARGYAHIGVIEELEARGYEITCIAGCSMGSVIGGIYAAGKLREYREW
VESLDYLDVLRLLDVSFRLGAIRGERVFGKIHEILGEVNIEDLSIPYTAVATDLTNQQEI
WFQEGCLHQAMRASAAIPSLFTPVMQGSRMLVDGGLLNPLPIVPVVSAHSDLIIAVNLNA
TNQKQYHLPVIERPAALKGRFDSMIESLGHKLSFFRRHGDDNTPPELSADALLHPVPAES
EEPAEPQLQQPAAAPQGKDSPKSASGTTVVESSGPASLLELVNQSFEVMQTSLAQYKIAG
YPPDILINVPKRVCRFFEFYKAPELIALGRQIASDTLDRYEEDNA
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagcaaacaggtcgccctggtattgggctccggcggtgcgcgcggctacgcgcacatc
ggcgtgatcgaggaactcgaggcacgcggctatgagatcacctgcatcgccggttgttcc
atgggctcggtgatcggcggcatctacgccgccggcaagctgcgcgagtaccgcgagtgg
gtggaaagcctggattacctcgacgtgctgcgcctgctcgacgtcagcttccgcctcggc
gcgatccgcggcgagcgggtgttcggcaagatccacgagatcctcggcgaggtaaacatc
gaggacctgtcgattccctacacggcggttgccaccgacctcaccaaccagcaggaaatc
tggttccaggaaggctgcctgcaccaggccatgcgcgcctcggcggcaatccccagcctg
ttcacaccggtcatgcagggcagccgcatgctggtcgacggcggcctgctcaacccgttg
ccgatcgtgccggtggtgtcggcccacagcgacctgatcatcgcggtcaatctcaacgcc
accaaccagaagcagtaccacctgccggtgatcgagcgtccggccgcgctcaaggggcgc
ttcgacagcatgatcgagagcctcggtcacaaactctcgttcttccgccgccacggcgac
gacaataccccgccggagctgagcgccgacgccctgctccatccggttccggcggaatcc
gaggagcccgccgagccgcaactgcaacagccggccgcggcgccgcaaggcaaggactcg
ccgaagtcggccagcggcaccacggtggtggaaagcagtggtccggcatcgctgctggaa
ctggtcaaccagagcttcgaggtgatgcagacctcgctggcgcagtacaagatcgccggc
tacccgccggacatcctgatcaacgtgccgaagcgggtctgccgcttcttcgagttctac
aaggcgccggaattgatcgccctcggccggcagatcgccagcgacaccctggaccgctac
gaggaagacaacgcctga

DBGET integrated database retrieval system