KEGG   Pseudomonas aeruginosa M18: PAM18_3408
Entry
PAM18_3408        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DUF4893
Other DBs
NCBI-ProteinID: AEO75891
Position
complement(3794151..3794756)
AA seq 201 aa
MSRPIPVSRVFACLTVLAACAHAGAAEPDWRGYTSEQQQRSVLAVEQDAEAINKRYYDSA
FEEFLPELEQLELSLAQPVVAVDEKGLLGDWKCRSTQADQYGIYRYPNFQCRIRRTDRGL
FLEKTSGSQRVSGYLFREGTQRYVFLGGATVNDEPQVAFSGLAHGAPAESDVVALLRPHA
GGFLLLFPERRGGYEVLEFSR
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtcccgtccgatccccgtttcccgtgtcttcgcctgcctcaccgttctcgccgcctgc
gcgcatgccggcgccgccgaaccggactggcgtggctacaccagcgaacagcagcagcgc
agcgtgctggccgtcgagcaggacgccgaggccatcaacaagcgctactacgacagtgcc
ttcgaggaattcctgccggaactggagcaactggaactcagcctggcgcagcccgtcgtc
gccgtcgacgagaaaggcctgctgggcgactggaagtgccgctcgacccaggccgaccag
tacggcatctatcgctatccgaacttccagtgccgcatccggcgtaccgaccgcggcctg
ttcctggagaagaccagcggttcgcagcgggtcagcggctacctgttccgcgaaggcacg
cagcgctacgtgttcctcggcggcgccacggtcaacgacgagccccaggtggccttcagt
ggcctggcccacggcgcgccggctgagtccgacgtggtcgcgctgctgcgcccgcacgcc
ggtggcttcctcctgctgttcccggaacggcgcggcggctacgaggtcctcgagttcagc
cgctga

DBGET integrated database retrieval system