KEGG   Pseudomonas aeruginosa M18: PAM18_3409
Entry
PAM18_3409        CDS       T01973                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00220  Arginine biosynthesis
paf00250  Alanine, aspartate and glutamate metabolism
paf00471  D-Glutamine and D-glutamate metabolism
paf01100  Metabolic pathways
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAM18_3409
   00220 Arginine biosynthesis
    PAM18_3409
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PAM18_3409
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3409
Enzymes [BR:paf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PAM18_3409
SSDB
Motif
Pfam: Glutaminase
Other DBs
NCBI-ProteinID: AEO75892
Position
complement(3794867..3795775)
AA seq 302 aa
MQQLLNEILDEVRPLIGRGKVADYIPALAGVEPNQLGIAVYSRDGELFHAGDALRPFSIQ
SISKVFSLVQAIQHSGEDIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRFAAPAQSMRDFVRRLCGNPEVVSDSVVARSEYQHRSRNAAAAYLMKSFGNFHNDVE
AVLLSYFHHCALRMSCVDLARAFCFLADKGFCKHSGEQVLNERQTKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAVVPGRFTVCVWSPELNAAGNSLAGIAALEKLSERIGWS
IF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcagcaactgttgaacgagattctcgatgaagtccgcccgctgatcgggcgcggcaag
gtcgccgactacatccccgcgctcgccggcgtcgagccgaaccagctggggatcgccgtg
tacagccgcgacggcgagctgttccatgccggcgacgccctgcggccgttttccatccag
agcatttccaaggtgttcagcctggtccaggcgatccagcattccggcgaggacatctgg
caacgccttggccacgagccctccggccagcctttcaactccctggtgcagctggagttc
gagcgcggcaagccgcgcaacccgttcatcaatgccggcgccctggtgatctgcgacatc
aaccagtcgcgtttcgccgcgccggcgcaatcgatgcgcgatttcgtccggcgcctgtgc
ggcaacccggaagtggtgtcggactcggtggtggcgcgctcggagtaccagcaccgctcg
cgcaacgcggcggcggcctacctgatgaaatcgttcggtaacttccacaacgacgtcgag
gcggtgctgctcagctatttccatcattgcgcgctgcgcatgagctgcgtcgacctggcg
cgggcgttctgcttcctcgccgacaagggcttctgcaagcacagcggcgagcaggtactc
aacgagcggcagaccaagcaggtcaacgcgatcatggccaccagcgggctatacgacgag
gccggcaactttgcctatcgggtcggcctgccaggcaagagcggtgtcggcggcggcatc
atcgcggtagtgccggggcgcttcacggtctgtgtctggtcgccggaactgaacgccgcg
ggcaattcgctggcgggtatcgccgcgctggagaaactcagcgagcggatcggctggtcg
atcttctga

DBGET integrated database retrieval system