KEGG   Pseudomonas aeruginosa M18: PAM18_3410
Entry
PAM18_3410        CDS       T01973                                 

Gene name
kdpE
Definition
(GenBank) two-component response regulator KdpE
  KO
K07667  two-component system, OmpR family, KDP operon response regulator KdpE
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
paf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3410 (kdpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAM18_3410 (kdpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paf02022]
    PAM18_3410 (kdpE)
Two-component system [BR:paf02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   PAM18_3410 (kdpE)
SSDB
Motif
Pfam: Response_reg Trans_reg_C Lipase_GDSL_2
Other DBs
NCBI-ProteinID: AEO75893
Position
complement(3795897..3796589)
AA seq 230 aa
MTQLQNSILLIDDEPQIRKFLRISLNAQGYRVLEAGTGEEGLAQAALNRPDLVVLDLGLP
DRDGQDILRDLREWSQVPVLVLSVRASEGEKVLALDGGANDYVTKPFGIQEFLARVRVLL
RQAAQGESPEASVAVGPLQVDFAYRRVTLEGAEVALTRKEYAVLAALARHLGRVVTQQQL
LKDIWGPTHVEDTHYLRVVVGHLRQKLGDDPASPRFLVTEAGVGYRLRDS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacccaattgcagaacagcatcctgctgatcgacgacgaaccgcagatccgcaagttc
ctccgtatcagcctcaatgcccagggctaccgggtgctcgaggccggcaccggcgaagag
gggctggcccaggccgcgctgaaccggccggacctggtggtgctcgacctcggcctgccg
gaccgcgacggccaggacatccttcgcgacctgcgcgaatggtcgcaggtgccggtgctg
gtgctgtcggtgcgcgccagcgagggcgagaaggtactggccctggatggcggcgccaac
gactacgtgaccaagccgttcggcatccaggagttcctcgcccgcgtgcgcgtcctgctg
cgccaggcggcgcagggcgaaagcccggaggcgtcggtggcggtcggcccgttgcaggtg
gacttcgcctatcgccgagtcaccctggagggtgcggaagtggcgctgacgcgcaaggag
tatgcggtgctcgccgcgctggcacgccatctcggacgggtagtgacccagcagcaactg
ctcaaggatatctggggtccgacccatgtcgaagacacccattacctgcgggtcgtggtc
ggccacctgcgccagaagctcggcgacgatccggccagcccgcgcttcctggtgaccgag
gcgggtgtcggttatcgcctgcgcgacagctga

DBGET integrated database retrieval system