KEGG   Pseudomonas aeruginosa M18: PAM18_3411
Entry
PAM18_3411        CDS       T01973                                 

Gene name
kdpD
Definition
(GenBank) two-component sensor KdpD
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3411 (kdpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paf01001]
    PAM18_3411 (kdpD)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paf02022]
    PAM18_3411 (kdpD)
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PAM18_3411 (kdpD)
Protein kinases [BR:paf01001]
 Histidine kinases
  OmpR family
   PAM18_3411 (kdpD)
Two-component system [BR:paf02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   PAM18_3411 (kdpD)
SSDB
Motif
Pfam: KdpD DUF4118 HATPase_c HisKA Usp HATPase_c_2 GAF_3 HATPase_c_3
Other DBs
NCBI-ProteinID: AEO75894
Position
complement(3796690..3799347)
AA seq 885 aa
MTDTARADALLADLPADGRGRLKVFLGAAPGVGKTFAMLQAAQAQLRQGVKLRAGVVETH
SRAETESLLAGVPQQPLRSLEYRGMKLQEMDLDGLLADPPALALVDELAHSNVPGSRHAK
RWQDIQELLAAGIDVYTTVNVQHLESLNDQVRDITGVQVRETVPDWVLQEAYEIVLIDLP
PRELLERLREGKVYVPEQARAAIDAFFSQTNLTALRELAMQTAAARVDADLNHRYRQRGE
EAPALRGRLLVGIDGDEQAERLVRHACRVAERRHLPWSVVHVDTGGLRGEQARMRLQGAQ
QLAERLGGEIVVLRAGEVARTLLQHARERRASLVLVGQSRRRWYRRAFGGGLAGRLLRDG
QGLEISALDSEADLRPAEPRPRYPVVWNDYLLALLATALASGLAWIVAHLLELPNISLVF
LMAVLLVAVRSSLMPALLCAVASFLAYDFLFIPPHFSFAIHRHEDLLSLAFFLFMAGLTG
NLAARQRRQLEALRDTQEETSLLLELSRKLTAATDRQAVLAAAAQQFDDWKDVEVCLLGQ
VNGEWKTGAGVQRQLADQERVAADWAWAHDQPAGLGTGTLPGGRWWWWPLSAEEGPLALL
GVAPLDGQPLSPQRRRLLAALGQPLAQALARARLAEDLEAARLHGETEQLRSALLASVSH
DLRTPLTAMRGSIDSLLALGEAIPPADRRELLESTRDEAERLDRYIQNLLDMTRLGHGGL
KLARDWVAPGDIVGSALNRLRAVLAPYRVQAIVANDLPLLYVHAALIEQALINVLENAAR
FSPNHGRLRIEVSQDAAELRFAVSDEGPGIPEAEREKIFDMFYTAARGDRGGQGTGLGLA
ICQGMIGAHGGRISVGEGLDGRGTTLVLHLPLHPQPDLGQLEGDE
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgaccgacaccgcacgcgccgacgcgctgctggccgacctgcccgctgacgggcgcggc
cgcctgaaagtctttctcggcgcggcgccgggggtgggcaagaccttcgccatgctgcag
gccgcccaggcccagttgcgccagggcgtgaaactgcgcgccggggtggtcgagacccac
tcgcgggcggaaaccgagtccctcctcgcaggcgtgccgcagcagccgctgcgcagcctc
gagtatcgagggatgaaactgcaggaaatggacctcgacggtctccttgccgacccgccg
gcgctggccctggtcgacgaactggcccacagcaacgttcccggcagccgccacgccaag
cgctggcaggacatccaggagttgctggcggcgggaatcgacgtctacacaacggtcaac
gtccagcacctggagagcctcaacgaccaggtccgcgacatcaccggcgtgcaggtccgc
gagacggtgccggactgggtgttgcaggaggcctacgagatcgtcctcatcgacctgccg
ccgcgcgagctgctggagcgcctgcgcgagggcaaggtctacgtgccggaacaggcgcgg
gcggcgatcgatgcgttcttctcgcagaccaacctcaccgcgctgcgtgaactggcgatg
cagaccgccgccgcgcgggtcgacgccgacctcaaccaccgctaccgccagcgcggcgag
gaagcgccggcgttgcgcgggcggctgctggtgggcatcgacggtgacgaacaggccgaa
cgcctggtgcgccacgcctgccgggtcgccgaacgtcggcacctgccctggagcgtggta
cacgtcgataccggcggcttgcgcggcgagcaggcgcggatgcgcctgcagggtgcgcag
caactggccgagcggctcggcggcgagatcgtcgtgctgcgcgccggcgaggtggcgcgg
accctcctgcaacatgcccgcgagcgccgcgccagcctggtcctggttggccagtcgcgg
cgccgctggtaccgccgggccttcggcggtggtctcgccgggcgtctgctgcgcgacggc
cagggcctggagatcagtgccctggacagcgaggccgacctgcgcccggcggaaccgcgg
ccacgctatccggtggtgtggaacgactatctgctggcgctgctggcgaccgccctggcc
agcggcctggcctggatcgtggcgcacctgctggagctgccgaacatctccctggtgttc
ctgatggcggtgctgctggtggcagtgcgcagcagcctgatgccggcactgctgtgcgcg
gtggcgtcgttcctggcctatgacttcctgttcatcccgccgcatttttccttcgccatc
catcgccacgaagacctgctgagcctggcgttcttcctgttcatggccggcctcaccggc
aacctggcggcacgccagcggcgccagctggaggcgctgcgcgatacccaggaggaaacc
agcctgctgctggagctgtcgcgcaagctcaccgccgccaccgaccgccaggcggtgctg
gccgccgccgcccagcagttcgacgactggaaggacgtcgaggtctgcctgctcggtcag
gtcaatggcgagtggaagaccggggccggcgtgcagcggcaactcgccgaccaggaacgg
gtcgccgcggactgggcctgggcccacgaccagccggccggcctcggtactggcacgctg
cccggaggacgctggtggtggtggccgctgtcggcggaagagggaccgctggcactgctc
ggtgtcgcgccgcttgacggccagccgctgagcccgcagcgccggcgcctgctcgccgcc
ctcggccagcccctggcccaggccctggcgcgggctcgcctggccgaggacctggaggcc
gcgcgcctgcacggcgaaaccgagcaactgcgcagcgccttgctcgcctcggtctcccac
gacctgcgcacgccgctgacggccatgcgcggctccatcgacagcctgctggcgctgggc
gaggcgatcccgccggcggatcgtcgcgaactgctggaaagcacccgcgacgaggccgag
cgactggaccgctatatccagaacctgctcgacatgacccgtctcggccacggtggcctg
aagctggcgcgcgactgggtggcgccgggcgacatcgtcggcagcgcgctgaaccgcctg
cgcgcggtgctggcgccgtaccgggtgcaggcgatcgtggccaacgacctgccgttgctc
tacgtgcatgcggcgctgatcgagcaggcgctgatcaacgtgctggaaaatgccgcgcgc
ttctcgccgaaccacggccggttgcgcatcgaggtcagccaggatgccgccgagctgcgt
ttcgcggtgagcgacgaggggccggggattcccgaggccgagcgggagaagatcttcgac
atgttctacaccgctgcccgtggcgaccgcggtggccagggcaccggcctgggcctggcg
atctgccagggcatgatcggcgcccacggcgggcgcatcagcgtcggcgaaggcctcgac
ggtcgcggcaccacgctggtcctgcacctgccgctgcatccgcagccggacctcgggcaa
ctggagggcgacgaatga

DBGET integrated database retrieval system