KEGG   Pseudomonas aeruginosa M18: PAM18_3412
Entry
PAM18_3412        CDS       T01973                                 

Gene name
kdpC
Definition
(GenBank) potassium-transporting ATPase subunit C
  KO
K01548  potassium-transporting ATPase KdpC subunit
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3412 (kdpC)
SSDB
Motif
Pfam: KdpC
Other DBs
NCBI-ProteinID: AEO75895
Position
complement(3799455..3800006)
AA seq 183 aa
MFKQLRPALASLLVLSMVTGVAYPLLVTGIAQLAFPEQANGSLLRDAEGKVLGSRLIAQK
FNGEEWFHSRPSAGDYATVSSAASNLAPSNPALAERIARDAAQERIADQGPVPLALVTTS
GSGLDPQLPPQAARYQALRVATARGLPLRLVEDLVESHTERPLVGPAVVNVLALNMALAG
LKR
NT seq 552 nt   +upstreamnt  +downstreamnt
atgttcaagcaactccgtccggcactggcgtcactgctggtgctgagcatggtcaccggc
gtggcctatccgctgctggtcaccggtatcgcccaactggcgttccccgagcaggccaat
ggcagcctgctgcgcgacgccgagggcaaggtgctcggctcgcggctgatcgcgcagaag
ttcaacggcgaggagtggttccattcgcggccttcggcgggcgactacgccaccgtttcc
agtgccgcgagcaacctggcgccgagcaacccggcactggccgagcgcatcgccagggac
gccgcccaggagcgtatcgccgaccaggggccggtgccgctggcgctggtcactacctcc
ggtagcggactcgatccgcagctgccgccgcaggccgcgcgttaccaggcgctgcgggtg
gccacggcgcgcgggctgccgctgcggctggtggaagacctggtggaaagccacaccgag
cggccgctggtggggccggcggtggtcaacgtgctggcgctgaacatggcgctggcgggg
ttgaagcgctag

DBGET integrated database retrieval system