KEGG   Pseudomonas aeruginosa M18: PAM18_3413
Entry
PAM18_3413        CDS       T01973                                 

Gene name
kdpB
Definition
(GenBank) potassium-transporting ATPase subunit B
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3413 (kdpB)
Enzymes [BR:paf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     PAM18_3413 (kdpB)
SSDB
Motif
Pfam: Hydrolase E1-E2_ATPase HAD Hydrolase_3
Other DBs
NCBI-ProteinID: AEO75896
Position
complement(3800060..3802132)
AA seq 690 aa
MNAQTQASKNALHKSLERRHNASTSLAALWRPALLQAFVKLDPRQLLRSPVMLVVELTAV
LTTLLCFVPDQAVPTSVALQIALWLWFTVLFANFAEALAEGRGKARADSLKAGSQGLSAN
KRRADGSFESVVASSLRKGDVVRVQAGEMIPGDGEVIEGVAAVNEAAITGESAPVIRESG
GDRSAVTGNTQVVSDWLLVRIGANPGESTLDRMIALVEGAKRQKTPNEVALDILLIGLTL
IFLLVVVTLKPFALFAGGNLPLVFLVALLVTLIPTTIGGLLSAIGIAGMDRLVRLNVIAK
SGRAVEAAGDVHVLLLDKTGTITFGNRRCSALYAAPGVSGKELAEGALLASLADDTPEGK
SIVEYLRILHPIEEPRREELTPIAFSAETRLSGVDWNGQVYRKGAVDAALRFIDLPREKM
PEVLSREVDKIAQSGGTPLLVVANGRLLGAIHLKDVVKPGIRERFAELRRLGIRTVMVTG
DNPLTAAAIAAEAGVDDVIAEATPEKKLARIRQEQGEGRLVAMCGDGANDAPALAQADVG
MAMNDGTQAAREAANLVDLDSDPTKLLDVVQVGKELLVTRGALTTFSIANDVAKYFAILP
ALFVGIYPQLDVLNVMRLQSPQSAILSAIVFNALIIVALIPLALRGVRVQAADASQLLQR
NLLIYGVGGLVAPFLGIKAIDLLLTAVGLA
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgaacgctcagacccaggcgtccaagaacgccttgcacaaatcgctcgaacgtcgccac
aacgcgtccaccagcctcgccgccttgtggcggccggcgctgctgcaagccttcgtcaag
ctcgacccgcgccagttgctgcgctcgccggtgatgctggtggtcgaactgaccgccgtg
ctcaccaccttgctgtgcttcgtccccgaccaggcggtgccgacctcggtggcgctgcag
atcgccctctggctgtggttcaccgtgctcttcgccaatttcgccgaagcgctcgccgag
ggacgtggcaaggcccgcgcggacagtctcaaggccggcagccagggcctctccgccaat
aagcggcgcgccgacggcagtttcgagagcgtcgttgccagcagcctgcgcaagggcgat
gtggtacgggtccaggccggcgagatgattcccggcgacggcgaagtcatcgaaggcgtg
gcggcggtcaacgaggccgccatcaccggcgaatcggcgccggtgatccgcgagtccggc
ggcgatcgctcggcggtgaccggcaacacccaggtggtgtccgactggctgctggtacgg
atcggcgccaacccgggcgagtcgaccctggaccggatgatcgccctggtggaaggcgcc
aagcggcagaagacccccaacgaagtggcgctggacatcctgctgatcggcctgaccctg
atcttcctgctggtagtggtgaccctcaagccgttcgccctgttcgccggcggcaacctg
ccgctggtgttcctggtggcgctgctggtgacgctgatcccgaccaccatcggcggcctg
ctctcggccatcggcatcgccggcatggaccgcctggtgcgcctgaacgtgatcgccaag
tccggtcgcgcggtggaggcggccggcgacgtccacgtgctgctgctcgacaagaccggc
accatcaccttcggcaaccgccgctgcagcgcgctgtacgccgcgccgggggtgagcggc
aaggaactggccgagggcgcgttgctggcctcgctggccgacgacaccccggaaggcaag
tcgatcgtcgaatacctgcgcatcctgcatccgatcgaggagccgcgccgcgaggaactg
acgccgatcgccttcagcgcggaaacccgcctgtccggggtcgactggaacggccaggtg
taccgcaagggggcggtggatgcggcgctgcgcttcatcgacctgccgcgggagaagatg
cccgaggtgctttcgcgggaggtggacaagatcgcccagagcggcggcaccccgctgctg
gtggtagccaacggccggctgctcggcgccattcacctgaaggacgtggtcaagccgggc
attcgcgagcgcttcgccgaactgcgccggctgggcatccgcaccgtaatggtgaccggc
gacaacccgctgaccgccgctgccatcgccgccgaggctggggtcgacgacgtgatcgcc
gaggctaccccggagaagaaactggcgcggattcgccaggagcagggcgaaggtcgcctg
gtggcgatgtgcggtgacggtgccaacgacgccccggcgctggcccaggccgacgtcggc
atggccatgaacgacggcacccaggccgcccgcgaggcggccaacctggtcgacctggac
agcgacccgaccaagctgctcgacgtggtccaggtgggcaaggagttgctggtcacccgc
ggcgcgctgaccaccttttccatcgccaacgacgtggccaagtacttcgccatcctgccg
gcgctgttcgtcggcatctacccgcagctcgacgtgctcaacgtgatgcgcctgcaaagc
ccgcagagcgcgatcctgtcggccatcgtgttcaacgcgctgatcatcgtcgcgttgatc
ccattggccttgcgcggcgtgcgggtgcaggcggcggacgcttcgcaactgctgcagcgc
aacctgctgatctatggcgtcggcggcctggtggcgccgttcctcgggatcaaggcgatc
gacctgctgctgaccgccgtcggcctggcatga

DBGET integrated database retrieval system