KEGG   Pseudomonas aeruginosa M18: PAM18_3414
Entry
PAM18_3414        CDS       T01973                                 

Gene name
kdpA
Definition
(GenBank) potassium-transporting ATPase subunit A
  KO
K01546  potassium-transporting ATPase potassium-binding subunit
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3414 (kdpA)
SSDB
Motif
Pfam: KdpA Ecm33
Other DBs
NCBI-ProteinID: AEO75897
Position
complement(3802144..3803838)
AA seq 564 aa
MNSHEILLILAFFALVLVPAPFLGRYCFKVMEGQRNLLSAPLAPLERVCYRLFGVDPASE
QDWKTYTLALLAFNLAGLVLLFSILMLQGSLPLNPQHLPGLEWTLAFNTAVSFVTNTNWQ
AYSGEASLSYFSQMVGLTVQNFVSAAVGLCVLVALARGISRRSTRQLGNFWVDLTRGTLY
VLLPLCLLLALLLVWQGVPQTFFDYVHATTLQGAEQTIPLGPAASQIAIKQLGTNGGGFF
GVNSTHPFENPSAWSNLFEVASIILIPAALVFTFGHYVKDLRQSRAILGCMLLLFCLGLG
LSLWAEYQPNPALAQLPIEQGAPMEGKESRFGTAASMLWAITTTAASNGSVNAMHDSLSP
LGGMLPLLNMMLGEVIFGGVGAGLYGMLLFVLIAVFLAGLMVGRTPEYLGKKLEAKEVRL
LVFTLLVMPVGVLVLGAIAASLPGPASAVTNPGPHGFSQLLYAYTSGSANNGSAFAGFGA
NTPFHNLMIGLAMLIGRFGYILPILAIAGSLAAKKASPVGPNSFPTHGPLFVSLLTVTIL
LVGGLTFLPTLALGPIAEQLSLGF
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgaacagccacgagattctcttgatcctggcctttttcgccctggtcctggtgcctgca
ccgttcctcgggcgctactgcttcaaggtgatggaaggccaacgcaatctcctcagcgcg
ccgctggcgccactggagcgcgtctgctatcgcctgttcggcgtcgatccggcgagcgag
caggactggaagacctacaccctggcgctgctggcattcaacctggccggcctggtcctg
ctgttctcgatcctcatgctgcagggcagcctgccgctgaacccgcagcacctgccgggc
ctggaatggacactggcgttcaacaccgcggtcagtttcgtcaccaacaccaactggcag
gcctacagcggcgaggcctcgctgagctacttcagccagatggtcggcctcacggtgcag
aacttcgtcagcgcggcggtcggcctctgcgtgctggtggccctggcgcgcggcatcagc
cgccgctccacacgacagctgggcaacttctgggtcgacctgacccgcggcaccctctac
gtgctgctgccgctgtgcctgctgctggcgttgctgctggtctggcagggtgtgccgcag
accttcttcgactatgtccatgccaccaccttgcaaggcgccgagcagaccatcccgctc
ggcccggcggccagccagatcgccatcaagcagctgggcaccaatggcggcggcttcttc
ggcgtcaactcgacccatccgttcgagaacccgagcgcctggagcaacctgttcgaagtg
gcctcgatcatcctgatcccggcggcgctggtattcaccttcggccattacgtgaaggac
ctgcgccagagccgcgcgatcctcggctgcatgctgctgctgttctgcctcggcctgggc
ctgtcgctgtgggccgaataccagccgaacccggcgctggcgcagttgccgatcgagcag
ggcgcgccgatggagggcaaggagagtcgcttcggcaccgccgccagcatgctctgggcg
atcaccaccaccgccgcctcgaacggctcggtgaacgccatgcacgacagcctgagcccc
ctgggtggcatgctgccgctgctgaacatgatgctcggcgaggtgatcttcggcggcgtc
ggcgccggcctctacggcatgctgctgttcgtcctgatcgcggtgttcctcgccggcctg
atggtcgggcggacgccggagtacctgggcaagaaactcgaggcgaaggaggtccgcctg
ctggtcttcaccctgctggtgatgcctgtcggcgtgctggtgctcggcgccatcgccgcc
agcctgccggggccggcctcggcggtgaccaatcccggcccgcacggcttcagccaactg
ctctacgcctacacctcggggagcgccaacaacggctcggcgtttgccggtttcggtgcc
aacacgccgttccacaacctgatgatcggcctggccatgctcatcggccgcttcggctac
atcctgccgatcctcgccatcgccggcagcctggcggcgaagaaggccagcccggtgggg
ccgaacagtttcccgacccatggtccgctgttcgtcagcctgctcaccgtgaccatcctg
ctggtcggcggcctgactttcctgccgaccctggccctcggcccgatcgctgaacaactg
agcctcggcttctga

DBGET integrated database retrieval system