KEGG   Pseudomonas aeruginosa M18: PAM18_3415
Entry
PAM18_3415        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Potass_KdpF
Other DBs
NCBI-ProteinID: AEO75898
Position
complement(3803849..3804034)
AA seq 61 aa
MPSDAALNRFFTPPLRRLSLKRQRPLEGEIAHMTVLDWLSLALATGLFVYLLVALLRADR
A
NT seq 186 nt   +upstreamnt  +downstreamnt
atgccgtccgacgcggccctgaatcgcttctttacgccccctttgcggagactttccctc
aagcggcagaggccgctcgaaggagagatcgcacacatgaccgttctggattggttgtcc
ctggccctggccacgggactgttcgtctatttgctggtggcgctgctacgcgccgaccgt
gcctag

DBGET integrated database retrieval system