KEGG   Pseudomonas aeruginosa M18: PAM18_3416
Entry
PAM18_3416        CDS       T01973                                 

Definition
(GenBank) putative acyl-CoA dehydrogenase
  KO
K06446  acyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00930  Caprolactam degradation
paf01100  Metabolic pathways
paf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PAM18_3416
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     PAM18_3416
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-ProteinID: AEO75899
Position
complement(3804126..3805280)
AA seq 384 aa
MIRDPETLNLLLDSIRQFVRESLVPHEQEVAETDRIPEAIIARMREMGLFGLSIPEAYGG
LGVTMEEEVSIAFELGRTSPAFRSLLGTNNGIGSQGIVIDGTEEQKRRYLPRLASGELLS
SFCLTEPDSGSDAASLKTTAVRDGEHYVLNGTKRFITNAPQAGIYTVMARTDPAIRGAGG
ISAFVVERGTPGLSLGKPDRKMGQKGAHTCDVIFDDCRVPASQLIGGVEGVGFKTAMKVL
DKGRLHIAAVCVGVAERMLEDALRYALERKQFGQPIAEFQLIQAMLADSKAEAYAARCMV
IDAARQRDEGRDVGTEASCAKLFASEMCGRVADRAVQIFGGAGYIGDYGIERFYRDVRLF
RIYEGTTQIQQLLIARNMIRAAQG
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgattcgtgatccggaaaccctgaacctgctgctggacagcatccgccagttcgtccgc
gaaagcctggtgcctcatgagcaggaagtggcggaaaccgaccgcatccccgaggcgatc
atcgcccgcatgcgcgagatgggcctgttcggcctgtcgatcccggaggcctacggcggc
ctcggggtgaccatggaggaagaggtgagcatcgccttcgagctggggcggacctcgccg
gcgttccgttcgctgctgggcaccaacaacggcatcggctcccagggcatcgtcatcgac
ggcaccgaagaacagaagcggcgctacctgccgcgcctggcgtcgggcgaactgctcagt
tcgttctgcctcaccgaaccggactccggttccgacgccgcctcgctgaagaccacggcg
gtgcgtgacggcgagcactacgtgctcaacggtaccaagcgcttcatcaccaacgccccg
caggccggcatctacaccgtgatggcgcgcaccgacccggcgatccgtggcgccggcgga
atctccgctttcgtcgtcgagcgcggtacgcccgggctgtccctgggcaagccggatcgc
aagatgggacagaagggcgcgcatacctgtgacgtgatcttcgacgactgccgggtgcct
gccagtcagttgatcggcggggtcgagggcgtcggcttcaagaccgcgatgaaggtgctc
gacaagggccgcctgcacatcgccgcagtctgtgtgggggtcgccgagcggatgctcgag
gatgcgttgcgctatgccctggagcgcaagcagttcggccagccgatcgccgagttccag
ttgatccaggcgatgcttgccgacagcaaggccgaagcctacgcggcgcgctgcatggtc
atcgacgccgcgcggcagcgcgacgaaggccgcgatgtcggtaccgaggcgtcctgcgcc
aagctgttcgcctcggaaatgtgcggccgcgtcgccgaccgcgcggtgcagatcttcggc
ggcgccggctatatcggcgactacgggatcgagcgcttctatcgcgacgtgcggctgttc
cgcatctacgagggcaccacgcagatccagcaactgctgatcgcccgcaacatgatccgc
gccgcccagggctag

DBGET integrated database retrieval system