KEGG   Pseudomonas aeruginosa M18: PAM18_3417
Entry
PAM18_3417        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: HTH_IclR IclR MarR_2 MarR HTH_24 HTH_36 HTH_Crp_2 HTH_3 Rrf2
Other DBs
NCBI-ProteinID: AEO75900
Position
complement(3805335..3806201)
AA seq 288 aa
MRGNDERRSPAEGASTEAEVSAFEAVLIDPMQEKDEELKDRQFVTALARGLELLRCFTPR
ESLLGNQELAKKTGLPKPTVSRLTHTLTRLGYLRHLPHSGKYQLEVGVMSFGYAMLSNLS
IRALARPLMEEMAGYAKAAVAMAARDRLSMVYLDVVHGEANLTMRRQVGSHLSLHRSAIG
RACLAAMPEDEREFILGHIRKRHPEDWPEVRKGLERAFRDYADYGFCLSLGEWQRDVNAV
GVALHHESHGLLAFNCGGPSFHLKREKLEDDIGPRLLHMVHNIEAATR
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcgcggcaacgacgagcgccggagtccggcggaaggtgccagtacggaagcggaagtg
tccgccttcgaagctgtgctgatcgacccgatgcaggagaaagacgaggaactcaaggac
cgccagttcgtcaccgcgctggcccgcgggttggaattgctgcgctgtttcacgccacgg
gaaagcctgctgggcaaccaggaactggcgaagaagaccggcctgccgaagccgacggtg
tcgcgtctgacccacaccctgacccggctgggctatctgcgtcacctgccgcatagcggc
aagtatcaattggaagtgggggtgatgtcgttcggctacgcgatgctctcgaacctgtcg
attcgcgcgctcgcccgcccgttgatggaagagatggccggctacgccaaggccgcggtg
gccatggcggcccgcgaccggctgagcatggtctacctcgacgtggtgcatggcgaggcc
aacctgaccatgcgtcgccaggtcggcagccacctctcgctgcaccgcagcgcgatcggc
cgggcctgcctggcggcgatgccggaggacgagcgggaattcatcctcgggcacattcgc
aagcgccacccggaagactggccggaagtgcgcaaggggctggagcgggccttccgcgac
tatgccgactacggcttctgcctgtcgcttggcgagtggcaacgcgacgtcaacgcggtg
ggcgtggccttgcaccatgagagccatgggctgctggcgttcaattgcggcgggccgagt
ttccatctcaagcgcgagaaactggaggacgacatcggcccgcgcctgctgcacatggtc
cacaacatcgaggccgccacccgctga

DBGET integrated database retrieval system