KEGG   Pseudomonas aeruginosa M18: PAM18_3420
Entry
PAM18_3420        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: FCD GntR HTH_20 HTH_17 HTH_11 HTH_41 HTH_Crp_2 HTH_IclR HTH_24 Sigma70_r3 TrmB HTH_PafC HTH_8 HTH_23 HTH_21
Other DBs
NCBI-ProteinID: AEO75903
Position
3808899..3809546
AA seq 215 aa
MTIPLKRSLVDIALEQIRQRIDAGHWPLGQRLPPEPELAELLGMSRNTVREAVRVLTFSG
VLEVRQGDGTYVRACADPLETMLVLARSAVQHSLEARGMIEIEAARLAAVRRDDSDLSAL
REHLDASRQRYGSADLQDYIEHDVRFHQRMVDAAHNPVLSELYRYFSQVIRTSLERTMAD
PQRAQPCFELHQQLLDAIERGDPDAAAAANRALLI
NT seq 648 nt   +upstreamnt  +downstreamnt
gtgaccattcccctcaagcgctccctggtggacatcgccctggagcagatccgccagcgc
atcgacgccggccattggccgctcggccagcgcctgccgccggagccggaactcgccgag
ctgctcggcatgagccgcaacaccgtgcgcgaagcggtgcgggtgctgaccttctccggc
gtgctggaagtccgccagggcgacggcacctacgtgcgcgcctgcgccgatccgctggaa
accatgctggtgctggcgcgcagcgcggtgcagcactccctggaggcacgcgggatgatc
gagatcgaggcggcgcgcctggcagccgttcgccgcgacgacagcgacctgagcgcattg
cgcgaacatctcgacgcttcgcgccagcgctacggcagcgccgacctgcaggactacata
gagcacgacgtccgcttccaccaacggatggtcgatgccgcccacaatccggtgctcagc
gaactctaccgctatttctcgcaggtcatccggacctcgctggaacgcaccatggccgac
ccacaaagggcccagccctgcttcgagctgcaccagcaactgctcgacgccatagaacgc
ggagacccggacgctgccgccgcggccaaccgcgcactgctgatctga

DBGET integrated database retrieval system