KEGG   Pseudomonas aeruginosa M18: PAM18_3421
Entry
PAM18_3421        CDS       T01973                                 

Definition
(GenBank) putative major facilitator superfamily (MFS) transporter
  KO
K03449  MFS transporter, CP family, cyanate transporter
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paf02000]
    PAM18_3421
Transporters [BR:paf02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    PAM18_3421
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: AEO75904
Position
3809562..3810836
AA seq 424 aa
MTHALNARPGAHPGHPPEELLIDAEVDDEPVPPAPPLRPWLLLLGLVLVALNLRPALSSL
APLLNQVRDDTGLSAAAAGLLTTAPVLCLGLFAPLAPRLARRIGAERSVLLILFCLAGGI
VLRSLFPVFGLFAGSVLAGASIGIIGVLLPGIVKRDFPRQAGVMTGVYTMALCLGAALAA
GATAPLEKLFGNWELALAFWSLPAILAAAFWLPQTRQGQHAHRQAFRVIGLWRDPLAWQV
TLYMGLQSSLAYIVFGWLPSILIDRGMTAVEAGLVLSGSVMLQLITALLAPWLAARARDQ
RLAVVLVMATTLAGLLGFLYAPLQTIWGWAVLLGLGQGGTFSIALALIVLRSRDAHVASH
LSGMAQGVGYTLAAMGPFMVGVVHDLTGGWNAVGYIFIGVAIAATLFGLGAGRSQYVGAR
SEHL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgactcacgccttgaatgcccggccgggagcgcaccccggccatcctccggaagaactg
ctgatcgatgccgaagtcgacgacgaaccagttccgccggcgccgccactacgcccctgg
ctgctcctgctgggcctggtgctggtggcgctgaacctgcgcccggcgctgtccagcctc
gcccccctgctcaaccaggtgcgcgacgataccggcctctcggccgctgccgccggcctg
ctgaccaccgcgccggtactctgcctggggttgttcgcgccgctcgcgccgcgcctggcc
cggcgtatcggcgccgagcgcagcgtgctgctgatcctcttctgcctggccggcggcatc
gtcctgcgcagcctgttcccggtgttcggcctgttcgccggcagcgtcctggccggcgcc
agcatcggcatcatcggcgtgctcctgccgggcatcgtcaaacgcgacttcccgcgccag
gccggggtgatgaccggggtctacaccatggccctgtgcctgggcgcagcgctcgccgcc
ggcgctaccgcgccgctggagaagctcttcggcaactgggaactggcgctggcgttctgg
tcgctgccggcgatcctcgccgccgccttctggctgccgcagacccgccagggccagcac
gcccatcgccaggccttccgtgtcatcggcctgtggcgcgacccgctggcctggcaggtc
acgctgtacatgggcctgcaatcgtccctggcctacatcgtcttcggttggctgccgtcg
atcctgatcgaccgcggcatgactgcggtggaagccggcctggtgctgtccggctcggtg
atgctgcaactgatcaccgccctgctcgcgccctggctcgccgctcgcgccagggaccag
cgcctggcggtggtgctggtgatggcgaccaccctcgccggcctgctcggcttcctctat
gcgccgctgcagaccatctggggctgggcggtcctgctcggcctcggccagggcggtacc
ttcagcatcgccctggcgctgatcgtcctgcgctcgcgcgacgcccacgtcgcctcgcat
ctgtcgggcatggcccagggcgtcggctacaccctggcggccatggggccgttcatggtc
ggcgtggtccacgacctgaccggcggctggaacgcggtcggctatatcttcatcggcgtc
gccatcgccgccaccctgttcggcctcggcgccgggcgcagccagtacgtgggggcccgc
agcgaacacctgtag

DBGET integrated database retrieval system