KEGG   Pseudomonas aeruginosa M18: PAM18_3422
Entry
PAM18_3422        CDS       T01973                                 

Definition
(GenBank) putative permease
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: AI-2E_transport
Other DBs
NCBI-ProteinID: AEO75905
Position
complement(3810888..3811955)
AA seq 355 aa
MFDNDRLLLRVLLFGLLGASLWVLAPFWSALFWAAVLAFASWPLMRMLTRLLGGRESLAA
GLLTLGWIVLVALPLIWLGFGLADNVRSLMELLKNLQVEGLPPPPSWMAGVPLIGDRLIG
WWDSIDQQGVAFFYVLKPYVGEVGNWLLARSAKIGGGILELVLSLILIFFFYRDGPRLES
IVHRALERLIGNRAEHYRDLVAGTVQRVVNGVIGTAAAQALLAWIGFMIAGVPGAMLLGL
LTFACSLLMVPPLVWGPATAWLFFKGDYGHGVFLGLWGFFIISGVDNILKPYLISRGGNL
PLVVVLLGVFGGLLAFGFMGLFLGPILLAVAYNLLSDWIASTPRTPPAEGRGPDA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgttcgataacgatcggctgttgcttcgcgtgctgctgttcggtctgctcggtgccagt
ctctgggtgctggcgccattctggtcggcgctgttctgggccgcggtgctggctttcgcc
agttggccgctgatgcgcatgctcacgcgcctgctcggtggccgcgagtcgctggcggcg
ggcctgctgaccctgggctggatcgtcctggtggcattgccgctgatctggctcggcttc
ggcctggcggacaacgttcgctcgctgatggagctgctgaagaatctccaggtcgagggc
ctgccgccgccgccttcgtggatggccggcgtaccgctgatcggcgaccgcctgatcggc
tggtgggactccatcgaccaacagggcgtggcgttcttctacgtgctcaagccctatgtc
ggcgaggtcggcaactggctgctggcgcgcagcgcgaagatcggcggagggatcctggaa
ctggtcctcagcctgatcctgatcttcttcttctaccgcgacgggccgcgcctggagtcc
atcgtccaccgtgccctggagcgcctgatcggcaaccgcgcggagcactatcgcgacctt
gtcgccggcaccgtacagcgggtggtcaacggggtgatcggtaccgccgcggcgcaagcc
ctgctggcctggatcggcttcatgatcgccggcgtaccgggagccatgctgctcggcttg
ctgaccttcgcctgcagcctactgatggtcccgccgctggtctggggtccggccaccgcc
tggctgttcttcaagggcgactatggccacggggtgttcctcggcctgtggggcttcttc
atcatcagcggggtggacaacatcctcaaaccctacctgatcagccgtggcggcaacctg
ccgctggtggtggtgctgctcggggtattcggcggcctgctggcgttcggcttcatgggc
ctgttcctcggcccgatcctgctggcagtggcctacaacctgctcagcgactggatcgcc
agcacgccgcggacgccgcccgccgaagggcgcggcccggatgcctga

DBGET integrated database retrieval system