KEGG   Pseudomonas aeruginosa M18: PAM18_3424
Entry
PAM18_3424        CDS       T01973                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAM18_3424
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     PAM18_3424
SSDB
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Other DBs
NCBI-ProteinID: AEO75907
Structure
PDB: 
4ECJ 4ECI

Position
complement(3812936..3813598)
AA seq 220 aa
MIDLYTAATPNGHKVSIALEEMGLPYRVHALSFDKKEQKAPEFLRINPNGRIPAIVDRDN
DDFAVFESGAILIYLAEKTGQLMPADVKGRSRVIQWLMFQMGGVGPMQGQANVFFRYFPE
KLQGAIDRYQHETRRLYEVLDGRLGEAEYLAGDYSIADIATYPWVRIHDWSGVAVDGLDN
LQRWIAAIEARPAVQRGLLVPRREKEGDDAIRTAQSMLTR
NT seq 663 nt   +upstreamnt  +downstreamnt
atgatcgatctctacaccgccgccacgccgaacggccacaaggtttccatcgccctcgag
gaaatgggcctgccctacagggtgcacgcgctgtcgttcgacaagaaggagcagaaggct
ccggaattcctcaggatcaatcccaacggccgcatcccggccatcgtcgaccgcgacaac
gacgacttcgccgtcttcgagtcgggcgcgatcctcatctacctcgccgagaagaccggg
caactgatgcccgccgacgtcaagggccgctcgcgggtgatccagtggctgatgttccag
atgggcggggtcggcccgatgcaggggcaggccaacgtgttcttccgttatttcccggag
aagttgcagggcgccatcgaccgctaccagcatgagacccggcgcctctacgaagttctc
gacggtcgcctgggcgaggccgagtacctcgccggcgactacagcattgccgatatcgcc
acctatccctgggtgcgcatccacgactggtccggtgtcgccgtcgacgggctggacaac
ctgcagcgctggatcgccgccatcgaggcgcgtcccgcggtgcagcgcggactgctggtg
ccgcggcgggagaaggagggcgacgacgccatccgtaccgcccagtcgatgctgacccgt
tga

DBGET integrated database retrieval system