KEGG   Pseudomonas aeruginosa M18: PAM18_3425
Entry
PAM18_3425        CDS       T01973                                 

Definition
(GenBank) putative hydrolase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase
Other DBs
NCBI-ProteinID: AEO75908
Position
complement(3813678..3814538)
AA seq 286 aa
MSLQVEEVRISLPHIELAAHLFGPPDGKPVIALHGWLDNAMSFSRLAPKLAGLRIVALDF
AGHGHSAHRAEGASYLLWDYALDVLMVAEQLGWERFSLLGHSMGAIVSVLLAGALPERIE
RLALIDGLIPYTGEADKAPQKLGEALKAQLALRHKRKPVYAELEKAVEARMRGVGEISRE
AAELLAQRGLEPVPGGYTWRTDARLTLPSPLRLTQAHALNFVRSVECPVSLVLAEQGMLA
VEPRMRALLETLPFERHHLPGGHHLHLDDEAGAQAVARVFAAFFAR
NT seq 861 nt   +upstreamnt  +downstreamnt
atgagcctgcaggtcgaggaagtacgcatcagcctgccgcacatcgaactggccgcgcat
ctgttcggtccgccggacggcaagccggtgatcgccctgcatggctggctggacaacgcc
atgagcttctcgcgcctggcgccgaagctcgccgggctgcgtatcgtcgccctcgacttc
gccggccacgggcattccgcgcatcgtgccgagggcgccagctacctgctctgggactac
gcgctggacgtgctgatggtggccgagcaactgggctgggagcgtttttccctgttgggg
cactcgatgggcgccatcgtctcggtgctgctcgccggggccttgcccgagcgcatcgag
cggctggcgttgatcgatggcctgattccctacactggcgaagccgacaaggcgccgcag
aagctcggcgaagcgctgaaggcgcaactggcgctacgccacaagcgcaagccggtctat
gccgagctggaaaaagccgtggaagcgcggatgcgcggggttggcgagatctcccgggag
gccgccgaactgctcgcccagcgcggcctggaaccggtgcccggtggctatacctggcgc
accgacgcgcgcctgaccctaccgtcgccgctgcgcctgacccaggcccacgcgctgaac
ttcgtgcgcagcgtggaatgcccggtcagcctggtgctggccgaacagggcatgctggcg
gtggagccgcgcatgcgggcgctgctggagaccctgccgttcgagcggcaccacctgccg
ggcgggcatcacctgcatctggacgatgaggccggggcgcaggcggtggccagggtcttc
gcggccttcttcgcgcgctga

DBGET integrated database retrieval system