KEGG   Pseudomonas aeruginosa M18: PAM18_3426
Entry
PAM18_3426        CDS       T01973                                 

Definition
(GenBank) putative hydrolase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Abhydrolase_6 Hydrolase_4 Thioesterase Ser_hydrolase Abhydrolase_1 Esterase Peptidase_S9
Other DBs
NCBI-ProteinID: AEO75909
Position
complement(3814535..3815347)
AA seq 270 aa
MSQSVFFAHANGFPSATYAKLFEALAPEYRVDHLEMHGHDPRFPVNDNWDNLVDELLHHL
ASLEQPVWGVGHSLGGVLHYHAALRRPELYRGVVMLDSPVLTLADRLVIRAAKRFGFIDR
ITPAGRTLGRREAFPDLEEARAYFSGKALFRRFDPDCLEAYVRHGLADSGGGSGLRLRFD
PATEISIYRSVPHSSPGRPRQLQVPLAMVRGRHSKVVLPHHTRLIRAMPRGEFMSLPGGH
MFPLERPRETAELLKGVFDRWSRATEERSA
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtcgcaatcggttttcttcgcccacgccaacggcttcccgtcggctacctacgccaag
ctgttcgaggcgttggcgccggagtatcgggtggatcacctggaaatgcacgggcacgac
ccgcgttttccggtgaacgacaactgggacaacctggtggacgaactgctgcaccacctc
gccagcctggaacagccggtctggggcgtcggccattccctcggcggcgtgctgcactac
cacgcggcgctgcgccggccggaactctaccgcggcgtggtgatgctcgattcgccggtg
ctgaccctcgccgaccgcctggtgatccgtgccgccaagcgcttcggcttcatcgaccgg
atcactccggccgggcgcaccctggggcgtcgcgaggcgttccccgacctggaagaggcg
cgggcgtacttctccggcaaggcgctgttccgccgcttcgaccccgattgcctggaggcc
tacgtacgccacgggctggccgacagcggcggcggttccggcctgcgcctgcgcttcgat
ccggccaccgagatcagcatctaccgtagcgtgccgcacagcagtccggggcgtccacga
cagttgcaggtgccgctggcgatggtgcgcgggcgacacagcaaggtggtgttgccgcac
cacacccggctgatccgggcgatgccgcgcggcgagttcatgtcgctgcccggcggccac
atgttcccgctggagcgcccgcgggaaaccgccgaactgctgaaaggcgtgttcgatcgc
tggtcgcgggcgaccgaggagcgttcggcatga

DBGET integrated database retrieval system