KEGG   Pseudomonas aeruginosa M18: PAM18_3427
Entry
PAM18_3427        CDS       T01973                                 

Definition
(GenBank) putative threonine efflux protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: AEO75910
Position
complement(3815449..3816090)
AA seq 213 aa
MQELSVLLTLAAVFAIALVSPGPDVALVVRTSLHQGRRAGLASALGLACGILLHTTLVLT
GVSLLLSRTPVLFAILQALGALYLAWLGVGALRAWLRRGDGQPGRLDGALPPSPLGPWLR
GVATNLFNPKALVFFIALLGSLIPAQMSLGGKLAVAALLFGMGACWFGLLSLTLTRPALQ
TRLLRAVPWLDAACGVVFLLVAAAILEHLVRSA
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcaggaattgtctgtcttgctgaccctggcggcggtgttcgccatagccctggtcagc
cccggtcccgatgtcgccctggtggtgcgcacgtccctgcaccaggggcggcgggccggc
ctggccagcgcgctggggctggcctgcgggattctcctgcataccaccctggtgctgacc
ggcgtgtcgctgctgctcagccgtacgcctgtgctgttcgccatcctgcaggcgctcggc
gcgctgtacctggcctggctcggcgtcggcgcgctgcgcgcctggctgcggcgcggcgac
ggccagccgggccggctcgacggggcactgccgccgtcgcccctggggccctggctgcgc
ggagtggcgaccaatctgttcaatcccaaggcgctggtgttcttcatcgccttgctcggc
agcctgattcccgcgcagatgtcgctcggcggcaaactggcggtggcggcgctgctgttc
ggcatgggcgcctgctggttcggcctgctcagcctgacccttacccgcccggccctgcag
acccgcctgttgcgcgcggtgccctggctggacgcggcctgcggggtggtgttcctgctg
gtggcggcggcgatcctcgagcatctcgtccgctctgcctga

DBGET integrated database retrieval system