KEGG   Pseudomonas aeruginosa M18: PAM18_3428
Entry
PAM18_3428        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: AraC_binding HTH_18 HTH_AraC Cupin_2 HTH_Tnp_ISL3 Sigma70_r3
Other DBs
NCBI-ProteinID: AEO75911
Position
complement(3816131..3816955)
AA seq 274 aa
MEQITHLSSGIPGVRLIDAEHNRFSFPRHFHLEYHIGLLLQGRHRYAAGGERRLAGAGDA
LLMAPESIHDGSSAGEEGYRIRVLALDADWLERASRDFSDGRRGAPRLTSSLVRDERLQQ
RLRQLHLGMLGGAAALENRLALEEHLWQALACLLSLGSSLRLEEGDREGFGQRDWTRLRD
WLESRLEYPPNLEELAAFCGLSPWQVLRRFRRHCGLPPHQWLTQLRLERALPLVLRGEQP
LSQVAQQFGFYDQAHFSRLFRRTYGLPPARLRQR
NT seq 825 nt   +upstreamnt  +downstreamnt
atggaacagatcacccatctcagcagcgggattcccggcgtacgcctgatagacgccgag
cacaaccgcttttcctttccccggcacttccacctggagtaccacatcggcttgctgttg
cagggccggcatcgctatgccgccggcggcgaacggcgcctggccggggccggcgacgcg
ttgctgatggcgccggaaagcatccacgacggcagcagcgccggcgaggagggctaccgt
atccgcgtcctggcgctcgatgccgactggctggagcgcgccagccgtgacttcagcgac
ggccgccggggggcgccgcgcctgaccagcagcctggtccgcgacgagcgtctgcagcag
cgcctgcgtcagttgcacctgggcatgctcggcggagcggcggcgctggagaaccgtctg
gccctggaagagcacctctggcaggcgctggcctgcctgctcagcctgggcagcagcctg
cgcctggaggagggcgaccgggaaggcttcggccagcgcgactggacgcggctgcgcgac
tggctggagtcgcgcctggagtacccgccgaacctggaggaactggccgccttctgcggc
ctgagcccctggcaggtgctgcggcgcttccgccgtcactgcggcctgccgccccaccag
tggctgacccaactgcgcctggagcgcgccttgccgctggttctgcgcggcgagcagcca
ttgagccaggtggcccagcagttcggtttctacgaccaggcgcacttcagccgtctgttc
cggcgcacctatgggttaccgccggcgcgcctgcgccagcgctga

DBGET integrated database retrieval system