KEGG   Pseudomonas aeruginosa M18: PAM18_3429
Entry
PAM18_3429        CDS       T01973                                 

Definition
(GenBank) putative thioesterase
  KO
K19222  1,4-dihydroxy-2-naphthoyl-CoA hydrolase [EC:3.1.2.28]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00130  Ubiquinone and other terpenoid-quinone biosynthesis
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PAM18_3429
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.28  1,4-dihydroxy-2-naphthoyl-CoA hydrolase
     PAM18_3429
SSDB
Motif
Pfam: 4HBT
Other DBs
NCBI-ProteinID: AEO75912
Structure
PDB: 
4QD8 4QD7 4QD9 4QDB 4QDA

Position
complement(3817013..3817450)
AA seq 145 aa
MSLWRQTPDLEQLNASQKNSIGDLLGIRFEAFDDESLTASMPVDSRTHQPFGLLHGGASV
VLAESLGSMASYLCVDTSQYYCVGLEVNANHLRGLRSGRVTAVARAIHLGRTTHVWDIRL
SGDDGKPSCIARLTMAVVPLAGRAG
NT seq 438 nt   +upstreamnt  +downstreamnt
atgagcctctggcgacaaacgcccgacctggagcaactgaacgcctcgcagaagaacagc
atcggcgacctgcttggcatccgcttcgaagccttcgacgacgagtcgctgaccgcgagc
atgccggtcgactcgcgtacccaccagccgttcggcctgctgcatggcggcgcctcggtg
gtcctcgcggaaagcctgggctcgatggccagctacctgtgcgtcgataccagccagtac
tactgcgtcggcctggaagtgaacgccaaccacctgcgtggcctgcgcagcggccgggtc
accgcggtggccagggcgatccacctggggcgcaccacccatgtctgggacatccgcctc
agtggcgacgacggcaagccgagctgcatcgcccgcctgaccatggcggtggtgccattg
gcgggcagggcgggctga

DBGET integrated database retrieval system