KEGG   Pseudomonas aeruginosa M18: PAM18_3430
Entry
PAM18_3430        CDS       T01973                                 

Definition
(GenBank) putative AMP-binding enzyme
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00061  Fatty acid biosynthesis
paf00071  Fatty acid degradation
paf01100  Metabolic pathways
paf01212  Fatty acid metabolism
paf02024  Quorum sensing
Module
paf_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAM18_3430
   00071 Fatty acid degradation
    PAM18_3430
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PAM18_3430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paf01004]
    PAM18_3430
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_3430
Enzymes [BR:paf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PAM18_3430
Lipid biosynthesis proteins [BR:paf01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PAM18_3430
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PAM18_3430
  Exosomal proteins of breast cancer cells
   PAM18_3430
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AEO75913
Position
complement(3817500..3819167)
AA seq 555 aa
MVTANRLPLEVFFEREKRHPQRRYLVQPIGGGRVEELSWGEVGDQARRAAAWLRSLDLPA
GSRIAIISKNCAHWIVTDLAIWMAGHVSVPLYPNLTAESARQVLEHSESAVVFVGKLDDW
PAMAPGVPEGIPTVAMPLHPEGRFDRQWSDLQACAPLEGDTPTAAEQLATLIYTSGTTGV
PKGVMHNFSSFAFAASRGVELFGTREDDRMLSYLPLCHVAERMFVEMGSLYGGTTVFFAE
SLDTFVEDMKRARPTLLFGVPRIWTKFQMGVYSKMPAQKLDRLLKLPILGRIVGRKVLAG
LGLDAVRYALCGAAPVPEALLLWYRRLGLDVLEVYGMTENSGYSHVCRPGRQKTGWIGQN
SPGVEVRISDEGEVQVRSGATMVGYYKEPEKTAEVLTADGFLRTGDKGEQDAEGNLRLTG
RMKEIFKTSKGKYVAPAPIENRLAVHDRIEQVCVVGEGLSAPLGLCVLSEVGRREALNGT
RGALESSLRAHLEQVNGALDKHERLVGLVLVQETWAVDNGFLTPTLKIKRNMVEGAYGSR
FHEWVERREAVLWHE
NT seq 1668 nt   +upstreamnt  +downstreamnt
gtggtcactgcaaatcgtctgccgctcgaagtcttcttcgagcgcgaaaagcgtcatccg
caacggcgttacctggtgcagcccatcggtggcggccgggtcgaggagctgagctggggc
gaggtgggcgaccaggcgcggcgtgcagccgcctggttgcgcagcctggatctccccgcc
ggcagccgtatcgcgatcatctcgaagaactgtgcgcactggatcgtcactgacctggcg
atctggatggccgggcacgtttccgtccccctctatcccaatctcaccgccgagtcggcg
cgccaggtgctggagcattccgagtcggcggtggtcttcgtcggcaagctcgacgactgg
ccggcgatggcgcccggagtccccgagggcataccgaccgtggccatgccgttgcacccg
gaagggcgtttcgaccgccagtggagcgacctgcaggcctgcgcgccgctcgaaggcgac
acgccgaccgctgccgagcaactcgccaccctgatctacacctccggaaccaccggcgtg
cccaagggggtgatgcacaacttcagcagtttcgccttcgccgccagccgcggcgtggaa
ctgttcggcacccgcgaagacgaccggatgctctcctacctgccgctgtgccacgtggcg
gagcggatgttcgtcgagatggggtcgctctacgggggaaccacggtgttcttcgccgaa
agcctggacaccttcgtcgaggacatgaagcgtgcgcggccgaccctgctgttcggcgtg
ccgcgcatctggaccaagttccagatgggggtgtattcgaagatgccggcgcagaagctc
gaccgcctgctgaagctgccgatcctcggccgcatcgtcggtcgcaaggtgctcgccggg
ctaggcctggacgcggtgcgctacgcgctctgcggcgcggcgccggtacccgaggcgctg
ctgctctggtatcgccgcctgggcctggatgtgctcgaggtctacgggatgaccgagaac
agcggttactcccacgtctgccggcccggcaggcagaagaccggctggatcggccagaac
agccccggcgtcgaggtacgcatcagcgacgagggcgaggtgcaggtgcgtagcggcgcg
accatggtcggctactacaaggagccggagaagaccgccgaggtgctcaccgccgacggt
ttcctgcgcaccggcgacaagggcgagcaggacgccgaaggcaacctgcgcctgaccggg
cggatgaaggaaatcttcaagaccagcaagggcaagtacgtggcgccggcgccgatcgag
aaccgcctggcggtacacgatcgcatcgagcaggtctgcgtggtcggcgagggcctcagc
gcgccgctggggctctgcgtgctctccgaggtcggtcgccgggaggccctcaacggtacc
cgcggggcgctggaaagcagcctgcgggcgcacctggaacaggtcaacggtgcgctcgac
aagcacgagcgcctggtcggcctggtcctggtgcaggaaacctgggcggtggacaacggt
ttcctcacgccgaccttgaagatcaagcgcaatatggtggaaggtgcctatggctcgcgc
ttccacgaatgggtggaacgccgcgaggccgtgctctggcacgaatga

DBGET integrated database retrieval system