KEGG   Pseudomonas aeruginosa M18: PAM18_3431
Entry
PAM18_3431        CDS       T01973                                 

Definition
(GenBank) putative phosphohistidine phosphatase SixA
  KO
K08296  phosphohistidine phosphatase [EC:3.1.3.-]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAM18_3431
Enzymes [BR:paf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     PAM18_3431
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: AEO75914
Position
complement(3819294..3819758)
AA seq 154 aa
MKLWLLRHGEAEPHASRDSERRLTAHGRKEVLQSAARLAGLPLDGILASPYVRAQQTAEL
VREALGLVEPVGTAPWLTPDDDPREVLGFLDERSERNLLLVSHQPLVGALGGLLVHGNRR
DPLPMSTASLAELEGDFAAAGLMTLVSLHHPRHG
NT seq 465 nt   +upstreamnt  +downstreamnt
gtgaaactctggctgttgcgccacggcgaggccgaaccgcacgccagccgggattccgag
cggcgcctgaccgcccatggccgcaaggaggtgctgcagagcgccgcgcggctggccggg
ttgccgctggacgggattctcgccagcccctacgtgcgcgcccagcagaccgccgagctg
gtgcgcgaggcactgggcctggtcgagccggtcggcaccgcgccctggttgacccccgac
gacgatccgcgcgaggtgctcggtttcctcgacgagcgcagcgagcgcaatctcctgctg
gtcagccaccagcccctggtcggggcgctgggcggtctgctggtgcatggcaaccggcgc
gatccattgccgatgagcactgcctcgctggccgagctggaaggcgacttcgccgccgcc
gggctgatgaccctggtctcgctgcatcacccgcggcacggctag

DBGET integrated database retrieval system