KEGG   Pseudomonas aeruginosa M18: PAM18_3432
Entry
PAM18_3432        CDS       T01973                                 

Definition
(GenBank) putative lipase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DUF4389 KleE
Other DBs
NCBI-ProteinID: AEO75915
Position
complement(3819755..3820096)
AA seq 113 aa
MSADPQARESIAIRILWMLLFVLVWQVAELLLGAVVVIQLVYRLIYGAPNGSLMAFGDSL
SQYLAQIGRFGTFHSDEKPWPFADWPSARAAEGEAAHSVPPAAHPARDEEPKL
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtccgcagacccgcaagcacgcgaatcgatcgccatccgcatcctctggatgctgctg
ttcgtcctggtctggcaggtcgccgaactgctcctcggggcggtggtggtgatccaactg
gtctaccgactgatctacggcgcaccgaacggcagcctgatggctttcggcgacagcctc
agccagtacctggcgcagatcggccgtttcggtaccttccacagcgacgagaaaccctgg
ccgttcgccgactggccgagcgcccgcgccgccgagggcgaggccgcccacagcgtgccg
cccgccgcgcacccggcgcgcgacgaagagccgaagttgtga

DBGET integrated database retrieval system