KEGG   Pseudomonas aeruginosa M18: PAM18_3433
Entry
PAM18_3433        CDS       T01973                                 

Gene name
gpsA
Definition
(GenBank) NAD(P)H-dependent glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00564  Glycerophospholipid metabolism
paf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAM18_3433 (gpsA)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     PAM18_3433 (gpsA)
SSDB
Motif
Pfam: NAD_Gly3P_dh_N NAD_Gly3P_dh_C F420_oxidored ApbA NAD_binding_2 NAD_binding_10 3HCDH_N Sacchrp_dh_NADP TrkA_N Semialdhyde_dh Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: AEO75916
Position
complement(3820110..3821132)
AA seq 340 aa
MTEQQPIAVLGGGSFGTAIANLLAENGQAVRQWMRDPEQAEAIRSRRENPRYLKGVKVHP
GVEPVTDLERTLADCQLIFVALPSSALRKVLQPHQAALTDKLLVSLTKGIEAHTFKLMSE
ILEEIAPQARIGVISGPNLAREIAEHELTATVVASEDDELCARVQAALHGRTFRVYASRD
RFGVELGGALKNVYAIMAGLAAAMDMGENTRSMLITRALAEMTRFAVKLGANPMTFLGLA
GVGDLIVTCSSPKSRNYQVGHALGEGLSLEEAVSRMGETAEGVNTLKVLKEKSDEMQVYM
PLVAGLHAILFEGRTLAQVIQLLMRGEPKTDVDFIPTTGF
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacagagcagcaaccgattgccgtgctcggcggcggcagtttcggcaccgccatcgcc
aacctgctggccgagaacggccaggcggtccgccagtggatgcgcgacccggagcaggcc
gaggcgatccgcagccgacgcgagaacccgcgctacctgaaaggggtcaaggtgcatccc
ggggtcgagccggtcaccgacctggagcgcaccctggccgattgccaactgatcttcgtc
gccttgccctccagcgccctgcgcaaggtgctgcaaccacaccaggcggcattgacggac
aagctgctggtgagcctgaccaagggcatcgaggcgcacaccttcaagctgatgagtgag
atcctcgaggaaatcgccccgcaagcccgcatcggggtgatttccggcccgaacctggcg
cgcgagatcgcagagcacgagctgaccgccacggtggtcgccagcgaggacgacgagctg
tgcgcccgcgtccaggcggccctgcacggccgcaccttccgcgtctacgccagccgcgac
cgcttcggagtggaactcggcggtgcgctgaagaacgtctacgcgatcatggccggcctg
gccgcggcgatggacatgggcgagaacacccgcagcatgctgattacccgcgcgctggcg
gaaatgacccggttcgccgtcaagctcggtgccaacccgatgacctttctcggcctcgcc
ggcgtcggcgacctgatcgtcacctgttcctcgccgaagagccgcaactaccaggtcggc
cacgccctcggcgaggggctcagcctggaggaggcggtatcgcgcatgggcgagaccgcg
gagggtgtgaacactctcaaggtactcaaggaaaagtccgacgagatgcaggtgtacatg
ccgctggtcgccggtctccatgcgatcctcttcgaaggccgcaccctggcgcaggtcatc
cagctgctgatgcgcggcgagccgaagaccgacgtcgatttcattcccaccaccggcttc
tga

DBGET integrated database retrieval system