KEGG   Pseudomonas aeruginosa M18: PAM18_3434
Entry
PAM18_3434        CDS       T01973                                 

Definition
(GenBank) putative outer membrane receptor protein
  KO
K02014  iron complex outermembrane recepter protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paf02000]
    PAM18_3434
Transporters [BR:paf02000]
 Other transporters
  Pores ion channels [TC:1]
   PAM18_3434
SSDB
Motif
Pfam: TonB_dep_Rec Plug
Other DBs
NCBI-ProteinID: AEO75917
Position
3821283..3823391
AA seq 702 aa
MPIASRAPASLTLLALLFGGKLAAADLFNDPSGVPEVLTATRLKQSPAEVPGSISVLDRE
LIVASGARDIPELMRLVPGMMVGYLSGNQPTVNYHGTSMSGARRLQVLIDGRSVYRPGLA
SVDWSDLPLALEDVERIEVFRGPNTVSYGANALMGVINIITRAPGESPGTRLKYTAGQRG
IRDWYASQSIALEDSDFRLSLSGQEDDGFDRDHDGHALRDGRRLSRFNLNASHSLAPNQS
LEWQLAAKEGSNQHPYAYRSPFPQVPDDIDNSDTLAHDYAGSLRWNVDLDPRHSFYIQGY
AQHWERRQEWNACEAAIAFSPQLAQLWELNPDYLRRFADDPTRLPPGSAQELQLATQVLD
QLRNGGLRPVCGRVDRNIRESRYDLEMQDTLSLGDNLRLLNGLSYRYDQANSETFYGGRV
SSQIWRLFSQLEWHAGEHWLLQGGGMLEDVKGSGSSFSPRLAVNYLFNPQHSLRAVYSEA
VRSPGMYENDVDWRYRVRHLTPAPYGQSEAYYFASAHGPGDLGKEHTRSREIGYNGFFRE
TGLAVDVRLFHEEITGLISDPLSVVDFSPDNGDRIRFSGAEGQLDWRLGLRDRLRATYAY
LDYDATSRYDRRLTARHGGSAGWMHDWGQGWSSALFYYGDDSLNGHRFERVDLRLAKRIP
LGKAALELAGVLQQRLDDEPLTFPDNRYDSRHLLYFSAEVTF
NT seq 2109 nt   +upstreamnt  +downstreamnt
gtgcccatcgcttcacgtgctcccgcctccctgaccctgctggccctgctgttcggcggc
aagctcgcggccgccgacctgttcaacgatcccagcggcgttcccgaagtattgaccgcg
acacgcctgaaacaatccccagcggaagttcccggcagcatcagcgtgctcgaccgcgag
ctgatcgtcgccagcggcgcccgcgacattcccgaactgatgcgcctggtcccgggcatg
atggtcggctacctgtccggcaaccagcccacggtcaactaccacggcaccagcatgtcg
ggggcgcggcgcctgcaggtgctgatcgacggccgctcggtgtaccgcccgggccttgcc
agcgtcgactggagcgacctgccgctggccctcgaggatgtcgagcggatcgaagtgttc
cgtgggccgaataccgtcagctacggcgccaacgcattgatgggggtgatcaacatcatc
acccgcgcccccggcgagtcgcccggcacgcgcctgaagtacacggcgggccagcgcggc
atccgcgactggtacgccagccagagcatcgccctggaagacagcgacttccgcctgtcg
ctgtccggccaggaagacgacggcttcgaccgcgaccacgacggtcacgccctgcgcgac
ggccgccggctcagccgcttcaacctcaacgccagccacagcctggcgccgaaccagagc
ctggagtggcaactggcggccaaggaaggctcgaaccagcacccctacgcctatcgctcg
ccgtttccccaggttcccgacgacatcgacaactccgatacgctcgcccacgactatgcc
ggttcgctgcgctggaatgtcgacctcgacccgcgccacagcttctatatacaaggctac
gcacagcactgggagcgccggcaggaatggaacgcctgcgaggcggccattgccttcagc
ccgcaactggcgcagctctgggaactgaacccggactacctgcgcaggttcgccgacgat
ccgacccggctgccgcccggcagcgcccaggagttgcaactggcgacccaggtcctcgac
cagctacgcaatggcggactgcgtccggtctgcggacgggtcgaccgcaacatccgggaa
agccgctacgacctggagatgcaggacaccctcagcctgggcgacaacctgcgcctgctg
aacggcctgagctaccgctacgaccaggcaaactccgagaccttctacggcggcagggtc
agcagccagatctggcggctgttcagccaattggagtggcatgccggcgaacactggctg
ctgcagggcggggggatgctcgaagacgtcaagggctccggcagttcgttcagcccgcgg
ctggcggtgaactacctgttcaacccccagcacagcctgcgcgcggtctattcggaggca
gtgcggtcaccgggcatgtacgaaaacgacgtcgactggcgctaccgggtccgccacctg
acaccggcgccctatgggcagagcgaagcctactacttcgccagcgcccacggccccggc
gacctgggcaaggaacacacccgttcgcgcgagatcggctacaacggttttttccgcgag
accgggctggccgtggatgtacgcctgttccacgaggaaatcaccggactgatcagcgat
ccgctcagcgtcgtcgacttcagtccggacaacggcgatcgcatccgcttctccggcgcg
gaaggccagctcgactggcgcctgggcctacgcgaccgcctgcgcgccacctacgcctat
ctcgactacgacgccaccagtcgctacgaccggcgcctgaccgcccgccacggcggctcg
gccggctggatgcacgactggggccaaggctggtccagcgccctcttctattatggcgac
gactcgctcaatggacatcgtttcgaacgcgtcgacctgcgcctggccaagcgcattccc
ctgggcaaggccgccctggaactggccggcgtgctccagcagcgtctcgacgacgaaccg
ctgacgtttcccgacaaccgctacgacagccgccacctgctctacttcagcgccgaggtg
acgttctag

DBGET integrated database retrieval system