KEGG   Pseudomonas aeruginosa M18: PAM18_3435
Entry
PAM18_3435        CDS       T01973                                 

Definition
(GenBank) putative ABC transporter substrate-binding protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: ABC_sub_bind
Other DBs
NCBI-ProteinID: AEO75918
Position
3823392..3824318
AA seq 308 aa
MRRLRPARRAFQALLALVFCCLPHVGEAAQLVLVSANQGAAVNAFRDALAQRRPQDQVEL
RTPAALAEGMVFADDTRLLLLGPEALAWRLRQHRAPPTLALLLNRVDGQRLLPGANGHGG
HGVGGLCVLWSDPPASRQLRLARLILPGIQRIGVLYGKDSEFLLDELRREARSQGLQLFV
ASSSNDDPRPLQFLLGNSDLLLGIDDKQLYNSQSIKSLLLGSYAKNRALLGPTAAFVKAG
SLASSYSDQEDWLDTLDELLGQAPRHWPLSLYPGHFKVLGNRQVARSLGIDLASDADLGR
RLAEGEEP
NT seq 927 nt   +upstreamnt  +downstreamnt
atgcgtcgcttgcgccccgcccgccgggctttccaggcgctgctcgcgctcgtcttctgc
tgtctcccgcatgtcggcgaggccgcgcaactggtcctggtcagcgccaaccagggggcc
gcggtgaacgcctttcgcgatgccctggcgcagcgacggccgcaggaccaggtggaactg
cgcacgcccgcggccctggcggaggggatggtcttcgccgacgacacccgcctgctcctg
ctcggccccgaggccctggcctggcgcctgcgccagcaccgggcgccgccgaccctggcg
ctgctgctcaaccgggtcgatggccagcgcctgctgccaggcgccaacggacatggcgga
cacggcgtcggaggtctctgcgtactctggagcgacccgccggcgtcccgccagctccgc
ctggcgcgcctgatcctgccgggcatccagcgcatcggcgtgctctacggcaaggacagc
gaattcctcctcgacgagcttcgccgcgaggcccgcagccaggggctccagctgttcgtc
gccagcagcagcaacgacgacccgcgcccgctgcagttcctgctcggcaatagtgacctg
ctgctcggcatcgacgacaaacagctgtacaactcgcagagcatcaagagcctgctgctc
ggaagctacgccaagaaccgcgcgctgctcggccccaccgcagccttcgtcaaggccggc
agcctggcgagcagctacagcgaccaggaggattggctggacaccctcgacgaattgctc
ggccaggcgcccaggcactggcccctcagcctctatccagggcatttcaaggtgctcggc
aatcggcaggtagcccgttccctgggtatcgacctggccagcgacgccgacctcggccgg
cgcctcgccgaaggagaagaaccatga

DBGET integrated database retrieval system