KEGG   Pseudomonas aeruginosa M18: PAM18_3436
Entry
PAM18_3436        CDS       T01973                                 

Definition
(GenBank) putative sensor/response regulator hybrid
  KO
K20974  two-component system, sensor histidine kinase [EC:2.7.13.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
paf02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3436
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PAM18_3436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paf01001]
    PAM18_3436
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paf02022]
    PAM18_3436
Enzymes [BR:paf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PAM18_3436
Protein kinases [BR:paf01001]
 Histidine kinases
  Other
   PAM18_3436
Two-component system [BR:paf02022]
 Other families
  SagS-HptB-HsbR (swarming activity and biofilm formation)
   PAM18_3436
SSDB
Motif
Pfam: HATPase_c Response_reg HisKA sCache_4 HAMP GRIP YscO HATPase_c_3 Cyclophil_like2
Other DBs
NCBI-ProteinID: AEO75919
Position
3824315..3826270
AA seq 651 aa
MSQRHGWDIRTRMLAISLGPALLLTLLLTAYFTYSRLQDLRQELTHTGQLIADQLAPAAE
YGVIAGNTPVLQKLLQATLDTPHVRFIEVRDRNDNILVYVEQLPGALQNAAPIDIFHSTI
QRQRIALASDPLLDGASEGDGQSGEDYLGRVVVGMSNDAFSQRQQEILLKAALLAAFALI
LTFLVARRLAQRLSAPISTMGQAVEAIQSGDYKTSLPILDDGEIGDLARHINNLASGLDR
ASREQEQAISQLISAREEAEQANRAKSDFLAMMSHELRTPMNGVLGMLQLLETTEQTREQ
AEYTALATESTEHLLKVINDILDFSRIERGALELECIPFNLLELVQGSALVFQHSAQQRG
LALELQIQAGLENIEVCGDPTRIRQILVNLLGNALKFTEEGAIHLSLEWQALDHDVLWLT
CAVHDSGIGISPERLEHMFDAFQQADSSISRRYGGTGLGLAIARTLAERMGGTLQAESKE
GSGSTFTLEIPLPFQQSPAHRQQAAGDAAPVAAGQEILLVEDNPVNQTVIEAMLRSLGYR
VTLVADGIQAVRSAERQRYDAILMDCRLPVLDGYSATREIRAQENGRQVPIIALTANALQ
GDRENCLQAGMNDYLAKPFKRAELQRILQRWIGSQPELPVTSNETGRGEPE
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgagccagcgccacggctgggacatccgtacccgcatgctggcgatcagcctgggcccg
gcgctgctgctgaccctgttgctcaccgcctacttcacctactcgcgcctgcaggacctg
cgccaggaactgacccataccggccagttgatcgccgaccagttggcgccggccgccgaa
tacggcgtgatcgccggcaacacgcccgtgctgcagaagctgctgcaggccaccctcgac
accccgcatgtgcgcttcatcgaggtacgcgaccgcaacgacaatatcctggtgtacgtc
gaacagttgcccggcgcgttgcagaacgccgcgccgatcgacatcttccactccaccatc
cagcgccagcgtatcgccctggccagcgacccgctgctggatggcgccagcgaaggcgac
ggccagtccggcgaggactacctcggccgggtggtggtcggcatgtccaacgacgccttc
agccagcggcaacaggaaatcctcctgaaggccgccctgctggccgccttcgccctgatc
ctcaccttcctcgtcgcgcgccgcctggcgcagcgcctgtcggcgccgatcagtaccatg
ggccaggcggtcgaggcgatccagagcggcgactacaagaccagcctgccgatcctcgac
gacggcgagatcggcgacctggcccgtcacatcaacaatctcgccagcgggctggaccgc
gcgagccgggaacaggaacaggcgatcagccaattgatcagcgcccgcgaggaagcggag
caggcgaaccgggcgaagtccgacttcctggcgatgatgagccacgagcttcgcaccccg
atgaatggcgtgctgggcatgctgcaactgctggaaaccaccgagcagacccgcgaacag
gccgagtacacggcgctggccaccgagtccaccgaacacctgctgaaggtcatcaacgac
attctcgatttctcaaggatcgaacgcggcgcgcttgaactggagtgcatccccttcaac
ctgctggaactggtgcaaggctccgccctggtgttccagcacagcgcccagcaacgcgga
ctggcgctggaattgcagatccaggccggcctggagaatatcgaagtctgcggcgatccg
acgcggatccgacagatcctggtgaatctgctgggtaatgcgctgaagttcaccgaggaa
ggcgccatccatctcagcctggagtggcaggctctcgatcacgacgtactgtggctgacc
tgcgcggtgcacgacagcggcatcggcatctcgccggaacgcctggaacatatgttcgac
gccttccagcaggcggattcgtcgatttcccgacgctacggcggcaccgggctcggcctg
gcgatcgccaggaccctggcggaacggatgggcggcaccctgcaggcagagagcaaggaa
ggctcgggatcgaccttcaccctggagattccgctgcccttccagcagtcgccggcgcac
cggcagcaggccgccggcgacgccgccccggtcgccgccggtcaggaaatcctcctggtc
gaggacaatccggtgaaccagacagtcatagaagccatgttgcgcagcctcggctatcgc
gtcaccctggtcgccgacggtatccaggcggtacgcagcgccgagcgccagcgctacgac
gcgatcctgatggactgccgcctgccggtgctcgacggctactcggcgacacgggaaatc
agggcccaggagaacggccggcaggtaccgatcatcgccctgaccgccaacgccctgcag
ggcgatcgggagaactgcctgcaggcgggaatgaacgattacctggccaagccattcaaa
cgggcggaattgcaacgcatactgcaacgctggatcggctcgcagccggaactccccgtg
acatcgaacgaaaccggacgaggggagccggaatga

DBGET integrated database retrieval system